BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0119 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0384 + 16552194-16552621,16552909-16553173,16553239-16553337 28 6.7 >08_02_0384 + 16552194-16552621,16552909-16553173,16553239-16553337 Length = 263 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = +2 Query: 344 QSIN---DCDFFKFFLCSYC-FVTQSPYLFSS 427 QSIN +C F LC + F+T SP+LFSS Sbjct: 159 QSINLTPNCKFALVLLCMHHQFITNSPFLFSS 190 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,660,408 Number of Sequences: 37544 Number of extensions: 271660 Number of successful extensions: 462 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -