BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0114 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 33 0.007 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 28 0.25 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.3 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 33.5 bits (73), Expect = 0.007 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 29 NVDTTRAQMSVLP*SKLPSSHPQSTSPLVPGQLTPL 136 N+ T + VLP SK+P+S+P +P+VP P+ Sbjct: 31 NIRTGANNIGVLPASKMPTSYPSLPAPIVPSPGAPI 66 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 28.3 bits (60), Expect = 0.25 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 19 VPAKRGHYESPDVGPALVEAPIV--PSPVHVTPRSWTTYPSRPH 144 +P ++ H D GPAL API P P+ + P+RP+ Sbjct: 139 LPQQQQHPHQRDTGPALFPAPISHRPPPIAHQQAPFAMDPARPN 182 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 390 HDHGGHQGHVTNVHWARGHNGGVSHDH 310 H H H G+ + G +GG +HDH Sbjct: 124 HHHHHHHGNNGGGNGGGGGSGGNAHDH 150 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 213 TFDCSGSTLSTGVALAASLMLIRMWTRGV 127 T CS TGV + S++L RM GV Sbjct: 1160 TVHCSAGVGRTGVFITLSIVLERMQYEGV 1188 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,737 Number of Sequences: 2352 Number of extensions: 8957 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -