BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0111 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 24 1.9 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 3.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 3.3 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 3.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 4.3 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 382 WAEVDGMCYSYDAHILVVILLREFGMV-NSKVNIRYFTG 269 W + G C S HI++V L EFG++ + K++ ++ G Sbjct: 46 WFKAIGTCGS---HIIIVGLFYEFGLITHVKLSSDWYMG 81 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 408 WIIAPCWMFGPKWMACVTRTMLTSL 334 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 408 WIIAPCWMFGPKWMACVTRTMLTSL 334 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 408 WIIAPCWMFGPKWMACVTRTMLTSL 334 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 355 SNTCHPLRPKHPAGCYYPTRCRNTPGYF 438 S++C + Y T CR PGYF Sbjct: 276 SHSCEACPAHSKSSDYGFTECRCDPGYF 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,793 Number of Sequences: 438 Number of extensions: 5972 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -