BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0103 (556 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0786 - 7606984-7607037,7607235-7607379,7608103-7608163,760... 29 1.9 01_07_0385 - 43212580-43213142,43213234-43213612 29 1.9 12_02_0304 + 17112677-17113195 29 2.5 03_05_0967 + 29265465-29266214,29267718-29267944,29268428-292685... 29 2.5 07_01_0759 + 5838726-5838879,5839654-5839778,5840168-5840264,584... 29 3.3 04_04_0906 - 29297188-29297706 29 3.3 08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625,571... 28 4.4 03_06_0203 - 32337928-32338025,32338745-32338820,32338905-323389... 28 4.4 02_02_0549 + 11410129-11412180 28 4.4 02_01_0627 + 4708648-4708836,4708975-4709064,4709579-4709664,471... 28 4.4 11_07_0002 - 27171791-27172222 28 5.8 10_02_0061 - 4812903-4812940,4813140-4813536 28 5.8 09_02_0279 + 6702517-6702948 28 5.8 08_02_1480 + 27401923-27402158,27402847-27402982,27403119-274031... 28 5.8 06_03_1118 + 27756288-27756337,27756505-27756619,27756883-277570... 28 5.8 06_03_0908 - 25858909-25859185,25859765-25859892,25860061-258607... 28 5.8 05_03_0235 - 10747649-10748118,10748226-10748314,10748477-107485... 28 5.8 07_03_1654 - 28416487-28416548,28416791-28416824,28418156-284182... 27 7.6 05_02_0043 + 5964749-5966406,5966725-5966791,5967174-5967329,596... 27 7.6 03_04_0198 - 18381668-18381830,18381903-18382060,18382164-183821... 27 7.6 02_01_0455 + 3266123-3266258,3266348-3266670,3267083-3267661,326... 27 7.6 01_05_0195 - 19111983-19112477,19112646-19113950,19114053-191143... 27 7.6 >08_01_0786 - 7606984-7607037,7607235-7607379,7608103-7608163, 7608273-7608465 Length = 150 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 257 SPQIEVLPFVSAITSPARWG*APALAAEPPTILV 156 +P LPF S + + AR G APAL+A P LV Sbjct: 10 APARSALPFRSRVAAAARPGRAPALSAAPGRRLV 43 >01_07_0385 - 43212580-43213142,43213234-43213612 Length = 313 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 389 GGGDPGASGEDVSCAKSEGELTSLGIPGPP--AVSSGHRA 276 GGGD GAS VS A + +G+ PP V +G RA Sbjct: 182 GGGDGGASSVVVSAAAAAARRLPVGVRKPPLHVVVTGERA 221 >12_02_0304 + 17112677-17113195 Length = 172 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 316 PRLVSSPSLLAQLTSSPEAPGSPPPV 393 PR SPS+ A+ T +P SPPPV Sbjct: 42 PRRAPSPSVTAEPTPAPVIAPSPPPV 67 >03_05_0967 + 29265465-29266214,29267718-29267944,29268428-29268557, 29268651-29268719,29268803-29268946,29269775-29270011, 29270897-29270998,29271131-29271396,29271766-29273410, 29274449-29275018 Length = 1379 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 365 GEDVSCAKSEGELTSLGIPGPPAVSSGHRAG 273 GED + A +EGE G PG A + G R G Sbjct: 203 GEDAAAAGAEGERKEGGEPGKAAAAPGGRIG 233 >07_01_0759 + 5838726-5838879,5839654-5839778,5840168-5840264, 5840948-5841421,5842017-5842354,5843039-5843197, 5843273-5843311 Length = 461 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -2 Query: 279 SGCWSVRKPAD*SSAIRECDHKSSKMGVSTSVGGRTTHNPGTVEVS 142 S + ++K S+ + +HK +G +SV RTTH G EV+ Sbjct: 109 SPAYHLQKECGASNFAKGLEHKGDTLGSVSSVEERTTHAQGRKEVT 154 >04_04_0906 - 29297188-29297706 Length = 172 Score = 28.7 bits (61), Expect = 3.3 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -1 Query: 292 AAVTER--VLVSKEARRLKFCHS*VRSQVQQDGGEHQRWRQNHPQSWYRRSQRLPRRA*D 119 AA+ ER V+ +E L CHS S V G + + SWYR +R R D Sbjct: 39 AALLERLGVVSCQEDNELPGCHSWCDSDVVDTGAMERLMQAKLSTSWYRLRRRASRGGSD 98 Query: 118 S 116 + Sbjct: 99 N 99 >08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625, 5711015-5711508,5711579-5711632,5712597-5712683, 5712684-5712776 Length = 900 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -3 Query: 392 TGGGDPGASGEDVSCAKSEGELTSLGIPGPPAVSSGHRAGVGQ*GSPQIEV 240 TG G +SG SC +G+ LGI G +V + GQ +P E+ Sbjct: 206 TGNGHGQSSGSSDSCRDDDGD---LGIDGNASVGDANAVKSGQVPAPAKEI 253 >03_06_0203 - 32337928-32338025,32338745-32338820,32338905-32338971, 32339181-32339275,32340062-32340151,32340293-32340340, 32340764-32341069 Length = 259 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 316 PRLVSSPSLLAQLTSSPEAPGSPPP 390 PRLVSSP+ L + P+ P P P Sbjct: 49 PRLVSSPAKLTDDATPPQPPPQPQP 73 >02_02_0549 + 11410129-11412180 Length = 683 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 336 LAFGTANIFSGGTRVTTSSVHMHGSYNMNNLHN-DVAVINHNHVGFNNN 479 LA +F+G V ++S H+ + ++ + N D IN+NHVG N N Sbjct: 129 LANNYMGLFNGTGSVGSASNHLF-AVELDTIQNPDFRDINNNHVGININ 176 >02_01_0627 + 4708648-4708836,4708975-4709064,4709579-4709664, 4710108-4710332,4711251-4711314,4711793-4712491, 4712657-4712764,4712920-4713051,4713183-4713359, 4713920-4713973,4714072-4714134,4714227-4714928, 4715048-4715175,4715563-4715839 Length = 997 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 374 GASGEDVSCAKSEGELTSLGIPGPPAVSSGHRAGVG 267 GA G V +K+ GE G P PAV GH A G Sbjct: 308 GALGHIVRMSKTIGEEIGCGHPVWPAVIHGHYASAG 343 >11_07_0002 - 27171791-27172222 Length = 143 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 392 TGGGDPGASGEDVSCAKSEGE---LTSLGIPGPPAVSSGHRAG 273 T GG PG SG S A + T G+ G PA + G G Sbjct: 44 TSGGSPGGSGTRSSAASTSSARAGSTPAGVRGSPAGAGGSPGG 86 >10_02_0061 - 4812903-4812940,4813140-4813536 Length = 144 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 38 WRWRPWSW---QKRLSNLTTTPRSVSPGPRVLSAPRKP 142 WRWR W W +R ++ T S++ G R+L R P Sbjct: 41 WRWRQWWWLEATRRANSSTAVGGSMAVG-RLLPRSRSP 77 >09_02_0279 + 6702517-6702948 Length = 143 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 392 TGGGDPGASGEDVSCAKSEGE---LTSLGIPGPPAVSSGHRAG 273 T GG PG SG S A + T G+ G PA + G G Sbjct: 44 TSGGSPGGSGTRSSAASTSSARAGSTPAGVRGSPAGAGGSPGG 86 >08_02_1480 + 27401923-27402158,27402847-27402982,27403119-27403168, 27403810-27403813,27404394-27404494,27405084-27406305 Length = 582 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 328 SSPSLLAQLTSSPEAPGSPPP 390 SS S + +SSP AP SPPP Sbjct: 7 SSTSSSSSASSSPRAPSSPPP 27 >06_03_1118 + 27756288-27756337,27756505-27756619,27756883-27757033, 27757219-27757301,27757424-27757519,27757615-27757757, 27757858-27757942,27758158-27758237,27758335-27758422 Length = 296 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 237 QNFNLRASLLTNTRSVTAAHCWRS 308 QN ++AS+LT+ + ++A CW S Sbjct: 190 QNLGIKASVLTDIFNCSSARCWSS 213 >06_03_0908 - 25858909-25859185,25859765-25859892,25860061-25860765, 25860882-25860944,25861031-25861084,25861338-25861514, 25861644-25861813,25862011-25862065,25862220-25862918, 25863110-25863173,25863515-25863723,25866138-25866227, 25866390-25866617 Length = 972 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 Query: 374 GASGEDVSCAKSEGELTSLGIPGPPAVSSGHRAGVG 267 GA V +++ GE S G P PAV GH A G Sbjct: 287 GALSHIVKMSRAIGEEISCGHPAWPAVIHGHYASAG 322 >05_03_0235 - 10747649-10748118,10748226-10748314,10748477-10748574, 10748934-10749046,10749107-10749200,10749557-10749589, 10749734-10749851,10750110-10750210,10751036-10751233, 10751337-10751471,10751752-10751830,10753650-10753738, 10753835-10753987,10754100-10754285 Length = 651 Score = 27.9 bits (59), Expect = 5.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 202 GGEHQRWRQNHPQSW 158 GG HQR R +HP +W Sbjct: 559 GGHHQRRRHHHPPAW 573 >07_03_1654 - 28416487-28416548,28416791-28416824,28418156-28418212, 28418401-28418450,28418968-28419025,28419136-28419182, 28419278-28419377,28419446-28419586,28419715-28419780, 28420024-28420118,28420440-28420629 Length = 299 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +1 Query: 316 PRLVSSPSLLAQLTSSPEAPGSPPPVS 396 PRLVSSP +L SSP A PP+S Sbjct: 24 PRLVSSP----RLASSPAACAEQPPIS 46 >05_02_0043 + 5964749-5966406,5966725-5966791,5967174-5967329, 5967782-5967865,5968020-5968073 Length = 672 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/63 (26%), Positives = 25/63 (39%) Frame = +3 Query: 276 RSVTAAHCWRSRDAQARQFTLAFGTANIFSGGTRVTTSSVHMHGSYNMNNLHNDVAVINH 455 + + A H RD L G F G + S+ + Y N LH +A + H Sbjct: 458 KGIIAHHLRTDRDVSQLFTKLTKGVVFDFYGNYYLMPLSLALEAHYQ-NRLHRWIAWLKH 516 Query: 456 NHV 464 NH+ Sbjct: 517 NHL 519 >03_04_0198 - 18381668-18381830,18381903-18382060,18382164-18382199, 18382344-18382439,18382632-18382709,18382921-18383073, 18383261-18383365 Length = 262 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 156 YQDCGWFCRQRWCSPPSCWTCDR 224 Y++ GW+ Q W PP DR Sbjct: 128 YEETGWYDGQMWVKPPEVLARDR 150 >02_01_0455 + 3266123-3266258,3266348-3266670,3267083-3267661, 3267866-3268336 Length = 502 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 482 SAHQPSQWKNNFAGTWAWAAGLA 550 SA + W + AG W W GLA Sbjct: 185 SASLTTYWTSKIAGGWGWRVGLA 207 >01_05_0195 - 19111983-19112477,19112646-19113950,19114053-19114322, 19118884-19118950,19119229-19119284,19119530-19119590, 19120181-19120297,19120570-19120682,19120774-19120848, 19121464-19122045,19122056-19122271,19122372-19122497, 19126152-19126190,19126266-19126360,19126423-19126962, 19127102-19127327,19127385-19127437,19127534-19127701, 19128353-19128707,19128785-19128876,19129891-19129993 Length = 1717 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -1 Query: 217 QVQQDGGEHQRWRQNHP---QSWYRRSQRLPRRA*DSRPGGYRSW 92 ++ + G EH+ W + H Q W R QR+ + P Y + Sbjct: 1463 RISRRGREHENWEETHHEYIQEWEARRQRIFPESEQYDPSSYEEY 1507 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,478,004 Number of Sequences: 37544 Number of extensions: 298717 Number of successful extensions: 1407 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -