BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0101 (776 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 31 0.010 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 3.6 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 31.1 bits (67), Expect = 0.010 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +2 Query: 284 NQRYGESVYCGWSPDPNTKIKARDCVDK----WYSEINEFSFGKEPEVL 418 N ++G + C WS PN +++ C D W ++ FS + E L Sbjct: 9 NPQFGLQLECNWSSGPNATLQSSACTDDLSSCWSEDMGSFSLPLDLEPL 57 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = -2 Query: 445 DYLCEMTTVQHFRLLAKGKLIDFAVPFIYAVSSFDLCI 332 D+ C++ ++Q+F L+A + ++ + F Y +S+++ I Sbjct: 374 DFDCDINSIQYFCLMA--RCLNTLI-FYYHISTYEYSI 408 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,628 Number of Sequences: 336 Number of extensions: 3512 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -