BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0100 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 1.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.5 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -1 Query: 261 YQQSVVLICKLCYAECSSVDHG--MISSLSNSTTKILLEPVPVSSVERLPLRSSF 103 Y +VV IC +CY+ V +I ++ + +I ++ + + S++ L R+ F Sbjct: 918 YTANVVCICHVCYSTIQEVSKSGELIHKIATNDHEI-IDKIEMFSLQILNERAGF 971 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 727 GTAEAIAEVDAISCHPTQLNALLCGNGLCRTADCEPPLGCSKDC 596 G + +V+ +SC L ++ LC CE +G S C Sbjct: 128 GWTGKVCDVEMVSCKDAALRKVVPLKKLCNNGTCE-DIGNSHRC 170 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,019 Number of Sequences: 336 Number of extensions: 3882 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -