SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0100
         (756 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                24   1.3  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    23   4.1  
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    22   7.1  
DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.               21   9.4  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    21   9.4  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -1

Query: 456 NHHHHHQPISL 424
           +HHHHHQ  SL
Sbjct: 351 HHHHHHQTQSL 361


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = +1

Query: 127 FNAGNWNRLEQ--NLRRRIGQAGYHTMV 204
           ++ GN+  ++   NLRRR+G   +HT +
Sbjct: 195 YSTGNFTCIQIVFNLRRRLGYHLFHTYI 222


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +3

Query: 204 LHWNIPRNTT 233
           LHW +P N+T
Sbjct: 301 LHWQLPHNST 310


>DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.
          Length = 132

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 11/47 (23%), Positives = 21/47 (44%)
 Frame = -1

Query: 228 CYAECSSVDHGMISSLSNSTTKILLEPVPVSSVERLPLRSSFNKVEA 88
           CY +C    HG++   +    +  L  +P S  +    +  FNK ++
Sbjct: 57  CYLKCFMTKHGILDKNAEVDVQKALRHLPRSMQD--STKKLFNKCKS 101


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +3

Query: 18  HAVLSTGSSC 47
           HA LSTG SC
Sbjct: 133 HACLSTGGSC 142


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 216,396
Number of Sequences: 438
Number of extensions: 5282
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23753925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -