BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0095 (577 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC020236-1|AAH20236.1| 240|Homo sapiens IGLV4-3 protein protein. 30 6.7 AJ235670-1|CAA15328.1| 69|Homo sapiens immunoglobulin heavy ch... 29 8.9 >BC020236-1|AAH20236.1| 240|Homo sapiens IGLV4-3 protein protein. Length = 240 Score = 29.9 bits (64), Expect = 6.7 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -2 Query: 315 VAGQVGLVGHFGAVLSVSVLSTPREA--IRTLPRGSRNLQARTSTLL 181 + GQVG V FG ++VLS P+ A + P S LQA +TL+ Sbjct: 117 IDGQVGWV--FGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLV 161 >AJ235670-1|CAA15328.1| 69|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 69 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 280 SEVTYKSDLSSHECGIRLTNPSEEDLGLWRCGMETETETHY 402 S +T DLS + + LT +++D+ ++ CG T H+ Sbjct: 18 SRITMSVDLSKKQFSLALTXVTDDDMAIYYCGGTTLGVIHF 58 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,626,404 Number of Sequences: 237096 Number of extensions: 1856006 Number of successful extensions: 5317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5307 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -