BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0093 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.3 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 2.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 3.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 8.9 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.9 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 465 YQIIKFDCWTHIHITVELIFVYFYI 391 Y CWT+I+ + L + FY+ Sbjct: 102 YATCVLSCWTNIYYIIILAWALFYL 126 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 465 YQIIKFDCWTHIHITVELIFVYFYI 391 Y CWT+I+ + L + FY+ Sbjct: 155 YATCVLSCWTNIYYIIILAWALFYL 179 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -3 Query: 487 WFMFKTYVPNYQIRLLDTYSYY 422 +F+F+TY+P+ I +L S++ Sbjct: 243 YFVFQTYLPSILIVMLSWVSFW 264 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 139 KFKRDLSHSNHCRSFNKIVLSIGIN 213 + K+ LS N +SFN VL +GIN Sbjct: 876 ELKKALSSINE-QSFNHFVLKMGIN 899 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/28 (25%), Positives = 13/28 (46%) Frame = -1 Query: 465 YQIIKFDCWTHIHITVELIFVYFYIYFN 382 Y CW +++ V L + FY + + Sbjct: 64 YAAAVMSCWMNVYYIVILAWAIFYFFMS 91 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 407 KISSTVI*ICVQQSNLIIWYICLKHKPVVA 496 K S V +C NL+ W I L VVA Sbjct: 406 KYSRIVFPVCFVCFNLMYWIIYLHISDVVA 435 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 407 KISSTVI*ICVQQSNLIIWYICLKHKPVVA 496 K S V +C NL+ W I L VVA Sbjct: 406 KYSRIVFPVCFVCFNLMYWIIYLHISDVVA 435 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,578 Number of Sequences: 438 Number of extensions: 3493 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -