BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0090 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 35 0.037 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 33 0.15 At4g39190.1 68417.m05549 expressed protein ; expression support... 32 0.34 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.1 At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel... 30 1.4 At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel... 30 1.4 At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel... 30 1.4 At5g16690.1 68418.m01954 origin recognition complex subunit 3-re... 30 1.4 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 29 1.8 At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 29 2.4 At3g13410.1 68416.m01686 expressed protein 29 2.4 At4g01960.1 68417.m00261 expressed protein 28 4.2 At1g41900.1 68414.m04840 myosin heavy chain-related similar to M... 28 4.2 At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, puta... 28 5.6 At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.6 At1g35420.1 68414.m04394 dienelactone hydrolase family protein l... 27 7.4 At1g22930.1 68414.m02866 T-complex protein 11 contains Pfam PF05... 27 7.4 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 27 9.8 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.8 At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase fa... 27 9.8 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 35.1 bits (77), Expect = 0.037 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Frame = -2 Query: 419 EIDLEVRFDIANSY--CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENRIS 246 E +E DI N CS +D+ EG+ L N+ L+ +S+GS+ D A NR+ Sbjct: 126 EDKVETNDDIKNEEAGCSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHNRVD 185 Query: 245 PSAEPTDAETLGT 207 E D L T Sbjct: 186 -RLESMDENNLAT 197 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 33.1 bits (72), Expect = 0.15 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 161 CVVSATSAPDST*SWLFPEFQHQSVPLKEKSDFQPRPEVFRFRRTCP*ERR 313 C +S +S P + FP FQH S L E++ F+ + + ++R+ C ER+ Sbjct: 638 CTLSGSSPPVGSLPKSFPPFQHPSHQLLEENGFK-QEKYLKYRKRCLNERK 687 >At4g39190.1 68417.m05549 expressed protein ; expression supported by MPSS Length = 277 Score = 31.9 bits (69), Expect = 0.34 Identities = 23/91 (25%), Positives = 38/91 (41%) Frame = -2 Query: 377 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENRISPSAEPTDAETLGTART 198 C S+ D V E G S D ++ SE +A ++ A+ + + T Sbjct: 98 CKSNDLYEDFVLESSRRGGFSQDEMRSGEKQSEAENEAKQSITENKAKENEEKQSITE-- 155 Query: 197 KLSRVPT*LTRRKCRELKSSALTSVTRPEKL 105 SRV +T +K + + S ++PEKL Sbjct: 156 --SRVKKSVTEKKTKRIISEKKVKQSKPEKL 184 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 435 GPAVNNFLEKIPVYLTDYA-AEVSRVWSTSPNS 530 G VN F E P Y+ DY A +VWS P S Sbjct: 223 GVIVNTFQELEPAYVKDYTKARAGKVWSIGPVS 255 >At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 710 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -3 Query: 532 DELGDVLQTRLTSAA*SVR*TGIFSRKLLTAGPTSRPKRLIWRLDLTSPIVIAAPMSLTM 353 DE+ +++ RL S +G F+R LL G + L W LD S + + P S Sbjct: 526 DEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGEFCGEELLTWALDPKSGVNL--PSSTRT 583 Query: 352 MLSARETEAVA 320 + + E EA A Sbjct: 584 VKALTEVEAFA 594 >At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -3 Query: 532 DELGDVLQTRLTSAA*SVR*TGIFSRKLLTAGPTSRPKRLIWRLDLTSPIVIAAPMSLTM 353 DE+ +++ RL S +G F+R LL G + L W LD S + + P S Sbjct: 533 DEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGEFCGEELLTWALDPKSGVNL--PSSTRT 590 Query: 352 MLSARETEAVA 320 + + E EA A Sbjct: 591 VKALTEVEAFA 601 >At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -3 Query: 532 DELGDVLQTRLTSAA*SVR*TGIFSRKLLTAGPTSRPKRLIWRLDLTSPIVIAAPMSLTM 353 DE+ +++ RL S +G F+R LL G + L W LD S + + P S Sbjct: 533 DEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGEFCGEELLTWALDPKSGVNL--PSSTRT 590 Query: 352 MLSARETEAVA 320 + + E EA A Sbjct: 591 VKALTEVEAFA 601 >At5g16690.1 68418.m01954 origin recognition complex subunit 3-related / ORC3-related low similarity to SP|Q9UBD5 Origin recognition complex subunit 3 (Origin recognition complex subunit Latheo) {Homo sapiens} Length = 556 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = -2 Query: 386 NSYCSSDVTDNDV-VCEGDGSGSLSNDVLKGKSSGSERPQDAAENRISPSAEPTDAETLG 210 +S+ SSD +ND+ G+ +G L+ V + S P+ A + + S E D + Sbjct: 17 DSFNSSDTAENDIRASSGNHNGKLTGIVKSKRRIESPSPKIAKRSEVE-SVEEEDGQFFS 75 Query: 209 TARTKL 192 T R K+ Sbjct: 76 TLRFKV 81 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -2 Query: 377 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENRISPS 240 CSS ++ VV EG+G ++ ++ + KS+ E D+ E I+ S Sbjct: 990 CSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEEKWIAMS 1035 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 19 IGELLRAADPLRRDGYAGSWSPPGASDIINFSGRVTDVKADDFSSLHLRRVSYVGT 186 +GE + +D L R GS + G +F G V + K DF+S S+VGT Sbjct: 218 VGEKI-LSDDLSRKLSVGSMTTDGNHSGDSFQGSVNEKKVHDFNSSCPMNYSFVGT 272 >At3g13410.1 68416.m01686 expressed protein Length = 321 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 443 GWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 312 GWSNF E LE D+A + ++ +DV + + +L N Sbjct: 70 GWSNFLCSEKKLEQPVDVALVFIGRELLSSDVSSKRNSDPALVN 113 >At4g01960.1 68417.m00261 expressed protein Length = 236 Score = 28.3 bits (60), Expect = 4.2 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -2 Query: 428 ASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSS--GSERPQD 267 + EE DL+V + + ++T N V EGD S ++ N V G+ S GSE+ D Sbjct: 6 SGEEEDLDVDIEDGRFNETQEITTNLVSAEGD-SENVLNHVWSGRLSFDGSEKSAD 60 >At1g41900.1 68414.m04840 myosin heavy chain-related similar to Myosin heavy chain, skeletal muscle, extraocular (MyHC-eo) (SP:Q9UKX3) {Homo sapiens} Length = 442 Score = 28.3 bits (60), Expect = 4.2 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = -3 Query: 439 GPTSRPKRLIWRLDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASP---PEAKDLR 269 G S PKR + ++ S +A+P M + EA ASA RA P +A ++ Sbjct: 302 GAPSSPKRARTQPEVVSDQRVASPREERMEPATATPEAAASAIGDPRAGPMAEDDAPEVG 361 Query: 268 TRLKIGFLLQRNR 230 L+ G +R+R Sbjct: 362 AGLQTGLRKRRSR 374 >At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 449 VDGWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 312 +DG+ N A E+ + V + N+Y + V N+V+ G+LS+ Sbjct: 44 LDGYMNIAMEQTEEYVNGQLKNTYGDAFVRGNNVLYISTTKGTLSD 89 >At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 491 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 435 GPAVNNFLEKIPVYLTDY-AAEVSRVWSTSPNS 530 G VN F E P Y+ DY + ++WS P S Sbjct: 218 GVIVNTFEELEPAYVRDYKKVKAGKIWSIGPVS 250 >At1g35420.1 68414.m04394 dienelactone hydrolase family protein low similarity to dienelactone hydrolase [Rhodococcus opacus] GI:23094407; contains Pfam profile PF01738: Dienelactone hydrolase family Length = 310 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 115 GRVTDVKADDFSSLHLRRVSYVGTRLNLVLA 207 GRV DV A D S VS+ GTR++ +A Sbjct: 205 GRVVDVLATDESGYFSTGVSFYGTRIDSAVA 235 >At1g22930.1 68414.m02866 T-complex protein 11 contains Pfam PF05794: T-complex protein 11 Length = 1131 Score = 27.5 bits (58), Expect = 7.4 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 512 PDTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLEVRFDIANS 381 PD + + ++++V +L V D W +E IDL++ + NS Sbjct: 708 PDYSCISNLMKEVSDELCQMVPDSWKVEITETIDLDILSQLLNS 751 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -2 Query: 356 NDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENRISPSAEPTDAE 219 N V G S++ND + SS S P + ISPS P +E Sbjct: 267 NRVGLPGQNPRSVNNDTISCSSSSSGSPGRSTFISISPSMSPKRSE 312 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 435 GPAVNNFLEKIPVYLTDY-AAEVSRVWSTSPNS 530 G VN F E P Y+ DY A +VWS P S Sbjct: 223 GVIVNTFQELEPPYVKDYKEAMDGKVWSIGPVS 255 >At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase family protein simlar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 585 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = -2 Query: 440 WSNFASEEIDLEVRFDIANS-YCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDA 264 W++ + + L+ RF + + + S +D D G S +D + S S RP D Sbjct: 181 WNDPSIPQPGLDRRFSVCDRVFFSHRPSDFDPSFRGSSSSHRPSDYSRRPSDYSRRPSDY 240 Query: 263 AENRISPSAEPTDA 222 + S P+D+ Sbjct: 241 SRRPSDYSRRPSDS 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,742,491 Number of Sequences: 28952 Number of extensions: 225038 Number of successful extensions: 741 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -