BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0088 (591 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 25 0.36 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 2.6 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.5 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 22 4.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 4.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 7.8 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 25.4 bits (53), Expect = 0.36 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 63 MKIRFCIFIHSRRINRCNFSQF 128 M R CI I S R N NFS+F Sbjct: 1 MSTRICIPISSGRTNGSNFSKF 22 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 288 KIEFLVYKNLMKACK*RISVNKSPNNCK 205 K EF L + C ++VNK +CK Sbjct: 37 KEEFDELGRLQRICNGEVAVNKCEGSCK 64 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 480 QRINLFSLNLHHQ 518 + INLFSL L HQ Sbjct: 328 RNINLFSLQLAHQ 340 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 480 QRINLFSLNLHHQ 518 + INLFSL L HQ Sbjct: 153 RNINLFSLQLAHQ 165 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 479 PTN*LIFFKSPSSIE*YQNLPPAEHSYNELPILRN*K 589 PTN F + N PP+ + +ELP L++ K Sbjct: 51 PTNPAFFHPGLLPLAWQANSPPSPPAPSELPALKSRK 87 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 263 FLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTST 361 +L+T I+Y+++ + F T +F TST Sbjct: 152 YLFTVYYIYYSVHEASIINFGYTLAKFMIFTST 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,010 Number of Sequences: 336 Number of extensions: 1863 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -