BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0087 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) 29 3.0 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 >SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) Length = 1115 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +3 Query: 60 DKTSGAFVLSDAPVFESQAGTNFSNELRTQQMFTIDFHGEGITSCN-KSVTRKIIICVIT 236 D SG L + + G N ++E + D G+G SCN +SV + + C + Sbjct: 113 DDDSGKISLRNLRRVARELGENMTDEELRAMIDEFDKDGDGENSCNCRSVPKGTLHCRES 172 Query: 237 GGRTSCS 257 SCS Sbjct: 173 SSERSCS 179 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 322 SNRNALLLHGRNRQGDGTYPRGLQEVLPPVITQI 221 S+ N+ L +NR+G GTYP P V+ ++ Sbjct: 724 SSDNSFSLEDKNREGPGTYPLRSGNAKPDVLAKL 757 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,787,402 Number of Sequences: 59808 Number of extensions: 465803 Number of successful extensions: 898 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -