BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0083 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_16333| Best HMM Match : SET (HMM E-Value=0.0053) 29 2.5 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 259 TLHTDIKFNAGHWCPKRRTE 318 T++ ++K +AGHWC R TE Sbjct: 1990 TIYPNLKCSAGHWCSGRSTE 2009 >SB_16333| Best HMM Match : SET (HMM E-Value=0.0053) Length = 483 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 199 LQATIELLKILRYLDRGQGNTLHTDIKFNAGHW 297 + AT+ +LR+L+ G + + +I FNAG W Sbjct: 51 IDATVVKRALLRFLNDGDVDKAYDEIVFNAGDW 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,880,073 Number of Sequences: 59808 Number of extensions: 336036 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -