BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0083 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62730.1 68418.m07875 proton-dependent oligopeptide transport... 30 1.5 >At5g62730.1 68418.m07875 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 589 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = -1 Query: 384 LTNKRRQS*VIQACSNRNQRNYFSAPLRAPVTCIKFYICMQCISLTS 244 L +R+ V+ CSN N +Y S+PL P+T + ++ +Q + L S Sbjct: 445 LVETKRKHVVVSCCSNNNSSSYSSSPL--PITFL--WVAIQYVFLGS 487 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,339,218 Number of Sequences: 28952 Number of extensions: 231729 Number of successful extensions: 385 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -