BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0080 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 36 4e-04 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.66 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 25 0.87 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 3.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.5 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 22 6.1 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.1 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.1 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 35.9 bits (79), Expect = 4e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 87 TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHC 230 +RIVGG+ P +AG+ G ICGA++++ +TAAHC Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTYEPGM--ICGATIISKRYVLTAAHC 204 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.66 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 165 HSSVRSQVQQDGGEHQRWRQNHPQSWYRRSQR 70 HSS ++Q QQ + Q+ +Q PQ ++ Q+ Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQ 1526 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.6 bits (51), Expect = 0.87 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 137 CWTCDRTDEWQNFH 178 CW CD+ +E++ H Sbjct: 467 CWVCDQCEEYEYVH 480 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 397 LHQQHPAHQPSQWKQQ 444 +H QHP QP Q + Q Sbjct: 172 MHTQHPHMQPQQGQHQ 187 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.5 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +2 Query: 137 CWTCDRTDEWQ 169 CW CD+ +E++ Sbjct: 557 CWVCDQCEEYE 567 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 605 VLNGSNGRSTAAETRRPLTSAAAE 676 V NG++ + E +RP T+ +AE Sbjct: 7 VKRSHNGKNGSPEEKRPRTAFSAE 30 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 338 SYNMDTLHNDVAIINHNHVGFTNN 409 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 338 SYNMDTLHNDVAIINHNHVGFTNN 409 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/44 (29%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 201 NTRSVTAAHCWRTRRAQ-AVSSPSLLAQLTSSPEAPGSPPPMSR 329 N R T H + S PS + ++ EAP PP R Sbjct: 941 NLRPATTYHLRIVAENEIGASDPSDTVTIITAEEAPSGPPTSIR 984 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,101 Number of Sequences: 438 Number of extensions: 3371 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -