BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0079 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0023 - 19325966-19326046,19326132-19326248,19326635-193267... 31 0.73 04_03_1018 + 21753634-21753640,21754282-21754315,21754413-217544... 29 2.9 >11_06_0023 - 19325966-19326046,19326132-19326248,19326635-19326703, 19326922-19327119,19327388-19327591,19327688-19327828, 19328416-19328625,19329330-19329944 Length = 544 Score = 31.5 bits (68), Expect = 0.73 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 79 AVMAVTGVGSSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVAR 231 A +A + IA +LKN KL ++++ + L +A + + GK+ + Sbjct: 405 AKLAANWIMGDIAAYLKNEKLSIDEIKLTPLELSELIASIRNGTISGKIGK 455 >04_03_1018 + 21753634-21753640,21754282-21754315,21754413-21754432, 21754485-21755782 Length = 452 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +3 Query: 327 GSGVNKNGLGIAIGHIDFFVNGRLVQPGCTNNLCSHNRAYEVFAAT 464 G ++ +G +GH+ + +G+ GC + S A E AA+ Sbjct: 320 GGAIHHGAVGALLGHLSWAASGKCASGGCAGAVPSALAAVEALAAS 365 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,343,161 Number of Sequences: 37544 Number of extensions: 379866 Number of successful extensions: 934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 934 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -