BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0079 (741 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48520.2 68414.m05423 glutamyl-tRNA(Gln) amidotransferase B f... 33 0.15 At1g48520.3 68414.m05424 glutamyl-tRNA(Gln) amidotransferase B f... 32 0.35 At1g48520.1 68414.m05425 glutamyl-tRNA(Gln) amidotransferase B f... 32 0.35 At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3)... 31 1.1 At4g00450.1 68417.m00062 expressed protein 28 5.7 At1g49590.1 68414.m05560 formin-binding protein-related similar ... 28 7.5 >At1g48520.2 68414.m05423 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 475 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +1 Query: 28 NVIVVDWSSFSLSTYSTAVMAVTGVGSSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGR 207 +V V ++ + + +A + S IA +LKN KL +N + + L +A + Sbjct: 394 DVSVAEYFDAVIGKGAEVKLAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDG 453 Query: 208 NLEGKVARITG 240 + GK+ + G Sbjct: 454 TISGKIGKEVG 464 >At1g48520.3 68414.m05424 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 488 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/68 (23%), Positives = 32/68 (47%) Frame = +1 Query: 28 NVIVVDWSSFSLSTYSTAVMAVTGVGSSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGR 207 +V V ++ + + +A + S IA +LKN KL +N + + L +A + Sbjct: 394 DVSVAEYFDAVIGKGAEVKLAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDG 453 Query: 208 NLEGKVAR 231 + GK+ + Sbjct: 454 TISGKIGK 461 >At1g48520.1 68414.m05425 glutamyl-tRNA(Gln) amidotransferase B family protein contains Pfam profiles: PF02934 PET112 family, N terminal region, PF02637 GatB/Yqey domain, PF01162 PET112 family, C terminal region Length = 550 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/68 (23%), Positives = 32/68 (47%) Frame = +1 Query: 28 NVIVVDWSSFSLSTYSTAVMAVTGVGSSIATFLKNLKLPLNKVHIVGFNLGAHVAGVTGR 207 +V V ++ + + +A + S IA +LKN KL +N + + L +A + Sbjct: 394 DVSVAEYFDAVIGKGAEVKLAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDG 453 Query: 208 NLEGKVAR 231 + GK+ + Sbjct: 454 TISGKIGK 461 >At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3) identical to SP|O65607 DNA mismatch repair protein MSH3 (AtMsh3) {Arabidopsis thaliana} Length = 1081 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 4/84 (4%) Frame = +3 Query: 267 NNVLRLGTNDAQYVEVIHTDGSGVNKNGLGIAIGHIDFFVNGRLVQPGCTNNLCSHN--- 437 N + L N Q +EV+ + G L + H RL++ T+ LC N Sbjct: 417 NTEMTLSANTLQQLEVVKNNSDGSESGSLFHNMNHTLTVYGSRLLRHWVTHPLCDRNLIS 476 Query: 438 -RAYEVFAATITHGKHYGNQCSTE 506 R V + G H +Q S+E Sbjct: 477 ARLDAVSEISACMGSHSSSQLSSE 500 >At4g00450.1 68417.m00062 expressed protein Length = 2124 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 210 FGRQSSKNYGSRPFGRDWENNVLRLGTNDAQYVEVIHT-DGSGVNKNGLGIAIG 368 + R K YGS P +W NN + + E+ HT G+G N LG+ G Sbjct: 1059 YTRYILKRYGSLPSVVEWHNN-FKATSEKKLLSELDHTRSGNGEYGNPLGVPAG 1111 >At1g49590.1 68414.m05560 formin-binding protein-related similar to formin binding protein 21 (GI:3550080) [Homo sapiens]; similar to formin binding protein 21 (GI:3550077) [Mus musculus]; similar to Dinap1-interacting protein 1 (GI:8745458) [Crypthecodinium cohnii] Length = 242 Score = 27.9 bits (59), Expect = 7.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 535 ISS*NGYCQTCKAWVWNVPSKYRH 606 +S N +C+ CK W+ N P+ R+ Sbjct: 6 VSQGNKWCEFCKIWIQNNPTSIRN 29 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,838,514 Number of Sequences: 28952 Number of extensions: 304188 Number of successful extensions: 788 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -