BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0077 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 26 0.26 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 25 0.60 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 25 0.79 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 25 0.79 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.79 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 0.79 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 24 1.0 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 24 1.0 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 24 1.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.8 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 1.8 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 1.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.2 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.2 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.6 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 5.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 7.4 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.8 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 26.2 bits (55), Expect = 0.26 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 373 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 471 ++ ++H + +YN NN +N+ N+N+ +NN Sbjct: 318 LSNKTIHNNNNYNNNNYNNNYN--NYNNNNYNN 348 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 25.0 bits (52), Expect = 0.60 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 373 VTTSSVHMHGSYNMNNLHNDVAVINHNHVGFNN 471 ++ ++H + +YN NN +N N+N+ +NN Sbjct: 85 LSNKTIHNNNNYNNNNYNN----YNYNNNNYNN 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 313 KIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 370 RVTTSSVHMHGSYNMNNLHNDVAVINHNHVGFN-NNIQRI 486 ++ +++ + +YN NN +N+ N+N + +N N I++I Sbjct: 80 KIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 403 SYNMNNLHNDVAVINHNHVGFNNN 474 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 403 SYNMNNLHNDVAVINHNHVGFNNN 474 S + N +HN+ N+N+ +NNN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 +GVFV CWLP Sbjct: 333 MGVFVVCWLP 342 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 LGVF+ CWLP Sbjct: 625 LGVFLICWLP 634 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 84 TPRSVSPGPRVLSAPRKPLTS 146 T S SP PR+ SAP +S Sbjct: 507 TNSSPSPNPRIASAPSSSTSS 527 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 152 TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGAS 256 +RIVGG+ P +AG+ G ICGA+ Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTYEPG--MICGAT 191 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 +GVF+ CWLP Sbjct: 341 MGVFIICWLP 350 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +1 Query: 166 WFCRQRWCSPPSCWTCDRTHE 228 W CR ++ S W D H+ Sbjct: 926 WSCRCKFLQELSSWVSDNAHK 946 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/54 (18%), Positives = 24/54 (44%) Frame = +1 Query: 394 MHGSYNMNNLHNDVAVINHNHVGFNNNIQRINLASGSNTLLVLGPGLPASAELP 555 + +YN NN +N+ + +N + + + G+ +GP + ++P Sbjct: 318 LSNNYNYNNYNNNYKPLYYNIINIEQIPVPVPIYCGNFPPRPMGPWISIQEQIP 371 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 594 LGVFVGCWLP 565 +G FV CWLP Sbjct: 312 VGGFVACWLP 321 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 363 SGEDVSCAKSEGELTSLGIPG 301 +G D+S + GE LG+PG Sbjct: 184 AGGDISSFITNGEWDLLGVPG 204 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.6 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 202 CWTCDRTHEWQ 234 CW CD+ E++ Sbjct: 467 CWVCDQCEEYE 477 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.6 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 202 CWTCDRTHEWQ 234 CW CD+ E++ Sbjct: 557 CWVCDQCEEYE 567 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 511 LLVLGPGLPASAELPMLLR 567 LL GP PA AE+P L+ Sbjct: 97 LLEAGPDEPAGAEIPSNLQ 115 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -1 Query: 594 LGVFVGCWLP 565 +GVF+ CW+P Sbjct: 278 MGVFLICWVP 287 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +1 Query: 373 VTTSSVHMHGSYNMNNLHN 429 ++ ++H + +YN NN +N Sbjct: 85 LSNKTIHNNNNYNNNNYNN 103 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +1 Query: 163 GWFCRQRW 186 GW C RW Sbjct: 377 GWICEHRW 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,082 Number of Sequences: 438 Number of extensions: 2899 Number of successful extensions: 36 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -