BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0073 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) 31 0.67 SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 31 0.89 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 30 2.0 SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) 29 4.7 SB_45529| Best HMM Match : DUF983 (HMM E-Value=0.48) 29 4.7 SB_29483| Best HMM Match : TerC (HMM E-Value=0.92) 29 4.7 SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_58969| Best HMM Match : Avidin (HMM E-Value=3.7) 28 6.2 SB_21915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) 28 6.2 SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) 28 8.3 >SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = +1 Query: 85 EAFFDEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEQTR 261 E +FDEYDYYNFD +++ G+ K R+K+EA +TN F P GH RK++ K N E+ R Sbjct: 2 EPYFDEYDYYNFD--RNVVEGNTRKGRSKREACLNTNRFCPGGHERKVLEKYRNTEKNR 58 >SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 36.3 bits (80), Expect = 0.024 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 97 DEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHS-RKIVTKLMNAEQTRR 264 D+YD Y+FD H G K ++KKEAS++ N GHS RK + + E R+ Sbjct: 5 DKYDDYDFDERLH--EGGARKGKSKKEASQNKN-VSTQGHSERKAAEYIQHGEDKRK 58 >SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) Length = 244 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 124 HDKHIFTGHGGKQRTKKEASEHTNHFDP----SGHSRKIVTKLMNAEQTRRLQT 273 H I+T H +T + ++H N+ + H+ +I T L+N QT R+ T Sbjct: 45 HAARIYTNHVNDSQTARIYTQHVNYSQTARIYTQHAARIYTNLVNDSQTARIYT 98 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 31.1 bits (67), Expect = 0.89 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +1 Query: 160 QRTKKEASEHTNHFDPSGH----SRKIVTKLMNAEQTRRLQTPNTRWIADQ*T 306 ++TK++AS TN H SRK T ++TR+LQ TR DQ T Sbjct: 119 RKTKRQASRKTNTSKRQDHYKHASRKTKTSQSQDQETRKLQDQKTRKPQDQKT 171 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -1 Query: 326 VLLLAIVVY*SAIHLVFGV*SLLVCS-AFMSFVTIFLEC-PDGSKWLVCSDASFLVRCLP 153 V +L I V+ S I L V S+++ S + + L C P S L CS +SFL+ C P Sbjct: 1164 VTILFITVF-SVIILFITVFSVIILFITVFSIIILLLPCSPSSSFSLPCSPSSFLLPCSP 1222 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = -1 Query: 326 VLLLAIVVY*SAIHLVFGV*SLLV----CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 159 V++L I V+ S I L V S+++ CS SF L C S L CS +SFL+ C Sbjct: 1174 VIILFITVF-SVIILFITVFSIIILLLPCSPSSSFS---LPCSPSSFLLPCSPSSFLLPC 1229 Query: 158 LP 153 P Sbjct: 1230 SP 1231 >SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 73 VNMSEAFFDEYDYYNFDHDKHI 138 V+ +AF+ +DYY F HD ++ Sbjct: 508 VSEGKAFYGSFDYYQFPHDSNL 529 >SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) Length = 420 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 73 VNMSEAFFDEYDYYNFDHDKHI 138 V+ +AF+ +DYY F HD ++ Sbjct: 66 VSEGKAFYGSFDYYQFPHDSNL 87 >SB_45529| Best HMM Match : DUF983 (HMM E-Value=0.48) Length = 294 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 281 VFGV*SLLVCSAFMSFVTIFLECPDGSKWLVCSDASFLVRCLP 153 +FG+ +LVC+AF F+T + C L FL+R +P Sbjct: 80 LFGIFIILVCAAFGGFITTRVSCGVLPSLLGMLIVGFLLRNVP 122 >SB_29483| Best HMM Match : TerC (HMM E-Value=0.92) Length = 586 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 532 VTSKIYRLLLGSFVALSRSKS 470 VTS IY L LGSF+AL R S Sbjct: 256 VTSVIYALWLGSFLALGRQSS 276 >SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1002 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = -3 Query: 318 ASHSCLLISNPSSVWCLKSSCLLGVHEFRDDLSRMPGRIEVV 193 A+ + L + SV L SSC HE R L R G IEVV Sbjct: 21 ATANSALTTRRGSVQILGSSCTKSNHEVRKALPRTYGIIEVV 62 >SB_58969| Best HMM Match : Avidin (HMM E-Value=3.7) Length = 706 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/77 (25%), Positives = 34/77 (44%) Frame = +1 Query: 70 NVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNA 249 +VN S+ + N HI+T H +T + ++H N + I T+ ++ Sbjct: 150 HVNDSQTARIYTQHVNDSQTAHIYTQHVSDSQTARIYTQHVN----DSQTAHIYTQHVSD 205 Query: 250 EQTRRLQTPNTRWIADQ 300 QT R+ T +T I Q Sbjct: 206 SQTARIYTQHTARIYTQ 222 >SB_21915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 263 DFKHQTLDGLLINRQLWLAEGLLSCQTKGGRYCGYPRSVRVDARL 397 +++ Q L G L QLW+ + SC ++ +CG + + L Sbjct: 53 EYRQQLLSGTLT--QLWVVASMRSCTSRYTGFCGVKEEINLQQAL 95 >SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) Length = 512 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 310 MASRRTIELPNERRTLLRIPEEC 378 + S RT +PN RTLL+IP C Sbjct: 461 LVSNRTDLIPNINRTLLKIPNYC 483 >SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) Length = 1633 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +1 Query: 121 DHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEQTRRLQTPN 279 ++ + I GG K + + T F P+ SRK KL +++ ++ L P+ Sbjct: 1294 ENSQTITRERGGDDNCKSSSLQRTEDFSPAQFSRKSPRKLTSSKGSQLLLRPS 1346 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,629,089 Number of Sequences: 59808 Number of extensions: 432282 Number of successful extensions: 1039 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1037 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -