BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0067 (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 29 0.052 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 28.7 bits (61), Expect = 0.052 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 305 SSNAFRFEGWGSRCNYTEIFELISQGGWRI 394 + N+ ++ G Y EI EL +GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 311 NAFRFEGWGSRCNYTEIFELISQGGW 388 +A R+ G Y EI E + GGW Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGW 315 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 508 FYIKSY*FA*HVLLFLCASFF 570 FY S F H+L LC+ +F Sbjct: 59 FYCVSITFNVHLLFLLCSGYF 79 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 508 FYIKSY*FA*HVLLFLCASFFFF 576 FY F H+LL +C +F++ Sbjct: 241 FYYAFILFTVHLLLLVCIYYFYY 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,935 Number of Sequences: 336 Number of extensions: 3800 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -