BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0067 (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 29 0.70 SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomy... 27 2.1 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 26 5.0 SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces... 25 8.7 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 29.1 bits (62), Expect = 0.70 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 203 KSVTRKIIICVITGGRTFVSPR 268 K +K+++C+I+ GRT + PR Sbjct: 229 KDAWKKVVVCIISDGRTKIHPR 250 >SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 336 PHPSNRNALLLHGRNRQGDGTYP 268 PHP N +LL G N Q D + P Sbjct: 97 PHPENSKIVLLMGSNAQNDPSSP 119 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 460 GGRAHSPPGIKWLLEPMDIYN 398 GG H P + WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 >SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces pombe|chr 2|||Manual Length = 1485 Score = 25.4 bits (53), Expect = 8.7 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 589 NDLEVIVNLRFFKTVIKSITKDVLVMPYSAVWSGCSLSASLHRCLLYFNVI 741 N ++V VN + S TK+ L SA S C+LS + + +V+ Sbjct: 403 NYVQVFVNCQIENPSFDSQTKETLTTKVSAFGSQCTLSDKFLKAIKKSSVV 453 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,984,743 Number of Sequences: 5004 Number of extensions: 58987 Number of successful extensions: 130 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -