BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0067 (747 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1749 - 39636951-39638102 31 1.3 03_01_0347 - 2730242-2730425,2730541-2730692,2730782-2730940,273... 29 5.2 01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633,207... 28 6.9 >01_06_1749 - 39636951-39638102 Length = 383 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -3 Query: 355 SIVTTAAPPFKPKRITASRQK*TGRWYLPARTHKG----PTTSNYANYNFAGYTF 203 S+ + AAPPF P RIT+ GR + + K PT S + AG TF Sbjct: 165 SVASAAAPPFDPSRITSYAAHPNGRAFFVSVARKDVPFFPTLSRGWPWLHAGSTF 219 >03_01_0347 - 2730242-2730425,2730541-2730692,2730782-2730940, 2734144-2734618,2734713-2734775,2734870-2735078 Length = 413 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 267 RGLTKVLPPVITQIIILRVTLLLHDVIPSPWKSIVNI 157 RGL KV V++ + +TL I SPWK+ ++I Sbjct: 179 RGLAKVAGTVVSFAGVTTMTLYKGTAISSPWKAPISI 215 >01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633, 2074790-2075123,2075271-2075487,2075575-2075685, 2076304-2076840 Length = 446 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 315 RFGLKGGAAVVTILRSLNLYLKVGGAFKL*MSMGSSNHLIPG 440 + G+ G V+ R + L +GG + ++MG + HL G Sbjct: 354 KLGILGALEVIDAARKARIALMIGGMVETRIAMGFAGHLAAG 395 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,479,656 Number of Sequences: 37544 Number of extensions: 398469 Number of successful extensions: 801 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -