BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0067 (747 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_53526| Best HMM Match : Cohesin (HMM E-Value=8.4) 29 5.3 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 327 SNRNALLLHGRNRQGDGTYPRGLTKVLPPVITQI 226 S+ N+ L +NR+G GTYP P V+ ++ Sbjct: 724 SSDNSFSLEDKNREGPGTYPLRSGNAKPDVLAKL 757 >SB_53526| Best HMM Match : Cohesin (HMM E-Value=8.4) Length = 248 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = -1 Query: 381 P*DISSKISV*LQRLPHPSNRNALLLHGRNRQGDGTYPRGLTKVLPPVITQIIILRVTLL 202 P +++K++ P P + + T+P T VLP +I + + +TLL Sbjct: 179 PTPVTAKVNADTSPTPTPVTAKVCVETAPPQVCVATFPPSRTLVLPSMIAIVHVNTITLL 238 Query: 201 LHDVIPSP 178 + D+ SP Sbjct: 239 IPDLTNSP 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,613,070 Number of Sequences: 59808 Number of extensions: 453781 Number of successful extensions: 841 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -