BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0064 (278 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC004144-1|AAC27979.1| 1007|Homo sapiens R34001_1 protein. 30 1.1 X89961-1|CAD56487.1| 116|Homo sapiens mitochondrial capsule sel... 29 2.6 X89960-1|CAA62000.1| 116|Homo sapiens mitochondrial capsule sel... 29 2.6 BC016744-1|AAH16744.1| 116|Homo sapiens sperm mitochondria-asso... 29 2.6 BC014593-1|AAH14593.1| 116|Homo sapiens sperm mitochondria-asso... 29 2.6 AL162596-3|CAI19552.1| 116|Homo sapiens sperm mitochondria-asso... 29 2.6 AB076978-1|BAD06454.1| 574|Homo sapiens Grb2-associated binder ... 28 4.6 BC107064-1|AAI07065.1| 457|Homo sapiens IL1RL2 protein protein. 28 6.1 AY129465-1|AAM93492.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AY074797-1|AAL74290.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AL590391-1|CAH72781.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AL391221-1|CAI16676.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AL355997-1|CAI20233.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AL157774-1|CAH73867.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AL121946-1|CAI20324.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 AK091971-1|BAC03782.1| 536|Homo sapiens protein ( Homo sapiens ... 28 6.1 AF480064-1|AAM44232.1| 4074|Homo sapiens polycystic kidney and h... 28 6.1 DQ100892-1|AAZ08898.1| 119|Homo sapiens immunoglobulin heavy ch... 27 8.0 >AC004144-1|AAC27979.1| 1007|Homo sapiens R34001_1 protein. Length = 1007 Score = 30.3 bits (65), Expect = 1.1 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCCYIRRC 146 C P Q C P WN C+ R C Sbjct: 965 CTPWPAQTCRPCWNTTRSCWCRPC 988 >X89961-1|CAD56487.1| 116|Homo sapiens mitochondrial capsule selenoprotein protein. Length = 116 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCC 131 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >X89960-1|CAA62000.1| 116|Homo sapiens mitochondrial capsule selenoprotein protein. Length = 116 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCC 131 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >BC016744-1|AAH16744.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCC 131 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >BC014593-1|AAH14593.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCC 131 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >AL162596-3|CAI19552.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 75 CQPTSLQCCAPLWNCIHCC 131 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >AB076978-1|BAD06454.1| 574|Homo sapiens Grb2-associated binder 2-like protein protein. Length = 574 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 7 SHFKPPTMDELPVPKGSWQSHHDANQRRFNA 99 SH PPT +P P G +SH A+QR +A Sbjct: 199 SHCVPPTWP-IPAPPGCLRSHQHASQRAEHA 228 >BC107064-1|AAI07065.1| 457|Homo sapiens IL1RL2 protein protein. Length = 457 Score = 27.9 bits (59), Expect = 6.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 87 SLQCCAPLWNCIHCC 131 +LQ C+P+W C CC Sbjct: 18 ALQSCSPVWGCGPCC 32 >AY129465-1|AAM93492.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AY074797-1|AAL74290.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AL590391-1|CAH72781.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive) protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AL391221-1|CAI16676.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive) protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AL355997-1|CAI20233.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive) protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AL157774-1|CAH73867.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive) protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AL121946-1|CAI20324.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 (autosomal recessive) protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >AK091971-1|BAC03782.1| 536|Homo sapiens protein ( Homo sapiens cDNA FLJ34652 fis, clone KIDNE2018254. ). Length = 536 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 337 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 368 >AF480064-1|AAM44232.1| 4074|Homo sapiens polycystic kidney and hepatic disease 1 protein. Length = 4074 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 114 NCIHCCYIRRCKNIRTGLPQLLASQVPGLSIH 209 +C+ CC+++R K+ +T ++ SQ +IH Sbjct: 3875 SCLVCCWLKRSKSRKTKPEEIPESQTNNQNIH 3906 >DQ100892-1|AAZ08898.1| 119|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 119 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 86 RWLASWCDCHEPLGTG 39 RW +SW DC +P G G Sbjct: 98 RWGSSWYDCFDPWGQG 113 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,333,482 Number of Sequences: 237096 Number of extensions: 568559 Number of successful extensions: 1238 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 76,859,062 effective HSP length: 70 effective length of database: 60,262,342 effective search space used: 1325771524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -