BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0061 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 5.9 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 22 5.9 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 5.9 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 7.9 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 421 TLLNLCVRCIEIKSEDLFK 477 T+ N CV+C + + ED+ K Sbjct: 65 TMKNGCVKCEQKQKEDVHK 83 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.8 bits (44), Expect = 5.9 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 4/77 (5%) Frame = -2 Query: 232 CDTLRRSGKKLSGLCLWADVPMNRSRNVENFMT-LKTQ*MISMKTTE*FPNLSVLFSL-- 62 CD++ + +L G D+ + N +F+T LK + N S +F + Sbjct: 253 CDSVAHTAGELLGAVYSLDLELKHIENFNDFVTALKDNVPVFAAARFYAINRSTIFRMFN 312 Query: 61 -KVYDLFIMKQFRRLYS 14 V L +M QF YS Sbjct: 313 AIVTFLIVMVQFETNYS 329 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 5.9 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 4/77 (5%) Frame = -2 Query: 232 CDTLRRSGKKLSGLCLWADVPMNRSRNVENFMT-LKTQ*MISMKTTE*FPNLSVLFSL-- 62 CD++ + +L G D+ + N +F+T LK + N S +F + Sbjct: 573 CDSVAHTAGELLGAVYSLDLELKHIENFNDFVTALKDNVPVFAAARFYAINRSTIFRMFN 632 Query: 61 -KVYDLFIMKQFRRLYS 14 V L +M QF YS Sbjct: 633 AIVTFLIVMVQFETNYS 649 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/25 (28%), Positives = 12/25 (48%) Frame = +3 Query: 96 SVVFIEIIYWVFRVMKFSTFRLRFI 170 SV+F +++ W F RF+ Sbjct: 150 SVIFFDVVVWGLSASDLGVFFKRFL 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,174 Number of Sequences: 336 Number of extensions: 3437 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -