BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0061 (737 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0196 + 13374054-13374456,13375145-13375707,13375935-133759... 29 2.9 07_03_0179 + 14801037-14801108,14801325-14802788 28 8.9 07_01_0353 + 2563807-2564496,2564595-2564660,2564853-2564918,256... 28 8.9 >09_03_0196 + 13374054-13374456,13375145-13375707,13375935-13375976, 13376059-13376087,13376309-13376534,13376970-13377008, 13377126-13377155 Length = 443 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -3 Query: 369 PILVTSSDYTRLTGRVGELTGL*PEDVANTNLSERSASRINHRIGSAT 226 P LV R+ G+VGEL + A T++ E A +++ +G T Sbjct: 283 PPLVKGQKRERVKGKVGELAPVPKRGKAATSMPESKAGKVDPEVGHRT 330 >07_03_0179 + 14801037-14801108,14801325-14802788 Length = 511 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = -1 Query: 254 ESTTGSEVRHTEKIRQETQWAVSMGRCTNESEPER*EFHDSKNPI---DDFYENHRIVSQ 84 E+ E+ H E + E++ + + EPE E H K P +D +E++ S Sbjct: 103 EAVPEVEIIHEESLHVESEPDSTADSSSQSQEPEEEEIHPPKIPFQFEEDLFEDYGNTSN 162 Query: 83 SKC 75 C Sbjct: 163 YSC 165 >07_01_0353 + 2563807-2564496,2564595-2564660,2564853-2564918, 2565044-2565115,2565196-2565261,2565355-2565417, 2565505-2565570,2565963-2566062,2567403-2567504, 2567772-2567995,2568200-2568314,2568653-2568763, 2568873-2569088,2569426-2569624,2570690-2570790, 2570872-2570919,2571052-2571236,2571345-2571462, 2571572-2571699,2571981-2572107,2572529-2572647, 2572770-2572938,2573078-2573162,2573247-2573320, 2573449-2573568,2574068-2574251,2574343-2574464, 2574548-2574755,2574885-2574958,2575047-2575185, 2575275-2575456,2575852-2576007,2576153-2576284, 2576508-2576566,2576913-2576945,2577065-2577196, 2577303-2577479 Length = 1675 Score = 27.9 bits (59), Expect = 8.9 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +1 Query: 424 LLNLCVRCIEIKSEDLFKCLRCQ 492 L N C R +++ ED+ +CL+C+ Sbjct: 1401 LANQCSRSYKVRFEDIGRCLKCE 1423 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,911,789 Number of Sequences: 37544 Number of extensions: 335498 Number of successful extensions: 636 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -