BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0061 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 3.9 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 181 PIDTAH*VS-CRIFSVCRTSDPVVDSRSTALAKVSVSNVLRLE 306 PI H C VCRT +PV+D +A VS S V R E Sbjct: 33 PISRTHYKDRCAYIFVCRTLEPVIDMCFHRMAGVSPSQVQRDE 75 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 297 EDVANTNLSERSASRINHRI-GSATH*EDPARNSVGCVYGQMY 172 E V SE + + + H+I G+ + D RNS+GC ++Y Sbjct: 3867 ESVTALESSENAVATLMHKIDGTLDNLSDEDRNSIGCSVTEIY 3909 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,464,002 Number of Sequences: 59808 Number of extensions: 408847 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -