BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0061 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.9 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 57 TLSENRTLRLGNYSVVFIEIIYWVFRVMKFST 152 +L + R GNYS + +++I+ R F+T Sbjct: 275 SLCQRRFEEQGNYSCLKVDLIFTRDRAFYFTT 306 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 629 RETSGMFADYDLAL-YPFDIKALQMGTVLTVP-YTRLP 736 R+ + +YD YPFD+ + T +TVP Y +P Sbjct: 54 RQAAMQSGEYDHTKNYPFDVDQWRGMTFVTVPRYKGVP 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,094 Number of Sequences: 438 Number of extensions: 3967 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -