BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0060 (714 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 3.3 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 5.7 U61152-1|AAB41307.1| 45|Tribolium castaneum TATH2 protein. 21 7.5 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +2 Query: 551 ETDCSIPCYVHSNRSKDLAGRNVESCFSLTVKQSKPAVLNVLGSVRFDLAF 703 ET + P Y S+ S+ NVE +L VK P V+G + F Sbjct: 288 ETGHNAPLYSPSSDSQYQKQLNVEHAANLWVKLGTPKEKLVIGMPTYGRTF 338 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 596 KDLAGRNVESCFSLTVKQSK 655 + L +N E CFSL +K K Sbjct: 515 RTLGNQNSEMCFSLKLKNKK 534 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 596 KDLAGRNVESCFSLTVKQS 652 +DLA RNV C + TVK S Sbjct: 616 RDLAARNVLVCENHTVKVS 634 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 385 RRSYIKARPRFGLATVDL 438 + SY+KA+ G+A VDL Sbjct: 398 KASYVKAKGLGGIAIVDL 415 >U61152-1|AAB41307.1| 45|Tribolium castaneum TATH2 protein. Length = 45 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 538 QQSLPTKDKDHLHRYFETL 482 +Q +P+ D DH FETL Sbjct: 21 RQVIPSLDADHKLSKFETL 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,175 Number of Sequences: 336 Number of extensions: 3504 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -