BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0059 (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0607 + 19168164-19168358,19168594-19168716,19168791-191689... 29 3.8 03_06_0213 - 32406047-32406742 29 3.8 05_03_0281 + 11560402-11560569,11561373-11561579,11562966-115631... 29 5.0 01_05_0513 - 22864657-22867899 28 6.6 >10_08_0607 + 19168164-19168358,19168594-19168716,19168791-19168946, 19169129-19169314,19169467-19169583,19169721-19169774, 19169854-19169925,19170430-19170535,19170658-19170754, 19171090-19171184,19172318-19172420,19172699-19172886, 19174928-19175183,19177187-19177325 Length = 628 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 21 SVQFQFGRTGCCISPLSSGKPSGQ*TVVAVCQLYYDFFV 137 ++ FQ+G SPL + K +G+ V Q DFF+ Sbjct: 275 AIGFQYGSPDAVCSPLINAKKTGRSLVETYAQYVQDFFI 313 >03_06_0213 - 32406047-32406742 Length = 231 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 577 LGDLDFYPSGGSGQSGCLDDACSILTLCFYA 669 LGD +F+ GG G+ G +D A T FY+ Sbjct: 148 LGDREFFGGGGGGRLGFVDVALVPFTAWFYS 178 >05_03_0281 + 11560402-11560569,11561373-11561579,11562966-11563174, 11563261-11563309,11563611-11563673,11563799-11565472 Length = 789 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/62 (30%), Positives = 35/62 (56%) Frame = -2 Query: 207 SVEVSSDSFTVIVYREDGAASEGERRSHNRVDRQQQRFTDLRASPMKEVKYNIPFSQIET 28 S++ +SD T I +E G +G+ +SH+ T+ A+P K++K ++ S ++T Sbjct: 601 SLQENSDGLT-ITSKEGGRKKKGKGKSHD--------VTETSAAPAKDMKDSLADSFLDT 651 Query: 27 VR 22 VR Sbjct: 652 VR 653 >01_05_0513 - 22864657-22867899 Length = 1080 Score = 28.3 bits (60), Expect = 6.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 623 DAWTMPAPFLRYVSTRIYQASSRW 694 +AW AP+ Y +++YQ+ W Sbjct: 474 EAWNTDAPYAAYTRSKVYQSPKLW 497 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,225,023 Number of Sequences: 37544 Number of extensions: 397883 Number of successful extensions: 1057 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -