BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0059 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 29 0.15 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.4 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 24 4.2 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 24 4.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.2 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 7.3 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 7.3 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 29.1 bits (62), Expect = 0.15 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 349 YNLQLRFRAYSHCRTWSRWTHRWY 420 Y+L+ RAY H T+ RW W+ Sbjct: 1000 YDLEPELRAYLHTNTYVRWGDPWF 1023 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 1.4 Identities = 28/113 (24%), Positives = 46/113 (40%) Frame = -2 Query: 351 VVKILMNSAINRPH*RALARPSVYNFDXDSSRRDYVYIFSGEVSGYDESVEVSSDSFTVI 172 VVK L+ I+ P + L P Y +SS R Y + + + + + D F + Sbjct: 3034 VVKPLIPKRIDAPLAQKLIAPETYE---NSSGR-YSSSGANSLGSFLSYLRIPLDWF--L 3087 Query: 171 VYREDGAASEGERRSHNRVDRQQQRFTDLRASPMKEVKYNIPFSQIETVRCSS 13 Y E+ EGE+ N + R + + M E Y + ++ V C S Sbjct: 3088 NYHEN--TPEGEQVHDNTIQRYKSHYKRTSKHSMIENCYPVTHGELNYVNCYS 3138 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 514 QDENFRVVSPTVERWVQSNNVR 449 QD + + S TV+ W+ NNV+ Sbjct: 153 QDNDSKHTSGTVQTWLADNNVK 174 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 439 PTYSSHYCSGPI-SPRLDSQP*NSHPDDANIVEVLHTTAGLIGYDYP 576 P++ S C+ S D Q NSHP++ +VE LIG + P Sbjct: 18 PSFLSRDCTTTTESTGTDQQMANSHPEEPIVVE-KENNITLIGINRP 63 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 514 DDANIVEVLH-TTAGLIGYDY 573 DDANI ++LH TT GL Y + Sbjct: 239 DDANINDLLHFTTKGLTMYRF 259 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 159 DGAASEGERRSHNR 118 DGA SEG R SH++ Sbjct: 1028 DGAPSEGRRLSHSK 1041 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 7.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 428 RNSNQPIPHIIALDPSLH 481 RNS +P+ H++ L+ L+ Sbjct: 175 RNSTEPVEHVLHLEEELY 192 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,543 Number of Sequences: 2352 Number of extensions: 14063 Number of successful extensions: 31 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -