BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0059 (727 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74033-3|CAA98477.1| 407|Caenorhabditis elegans Hypothetical pr... 29 4.5 Z70206-1|CAA94124.1| 407|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z74033-3|CAA98477.1| 407|Caenorhabditis elegans Hypothetical protein F38B7.3 protein. Length = 407 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/61 (29%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = +1 Query: 436 KPTYSSHYCSGP-ISPRLDSQP*NSHPDDANIVEVLHTTAGLIGYDYPLGDLDFYPSGGS 612 +P Y SGP + P P +P A + HTT + Y G Y GG Sbjct: 182 RPASGQSYPSGPQVPPAYGQYPQPGYPQPAGVPTSSHTTVIVRDGGYGGGGYGGYGGGGG 241 Query: 613 G 615 G Sbjct: 242 G 242 >Z70206-1|CAA94124.1| 407|Caenorhabditis elegans Hypothetical protein C49F8.1 protein. Length = 407 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +1 Query: 469 PISPRLDSQP*NSHPDDANIVEVLHTTAGLIGYDYPLGDLDFYPSGGSGQSGCLD 633 P+ + +Q + PD + L + G GY PL D P G+S +D Sbjct: 299 PLEVKQSAQTLFNDPDFQMLARSLQSGTGSSGYSNPLSARDIPPCSSDGRSVTID 353 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,680,486 Number of Sequences: 27780 Number of extensions: 313986 Number of successful extensions: 940 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -