BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0053 (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.13c |||cytoskeletal signaling protein|Schizosaccharomyce... 26 5.5 SPAC637.05c |vma2||V-type ATPase V1 subunit B |Schizosaccharomyc... 26 5.5 >SPAC637.13c |||cytoskeletal signaling protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 171 DTLHNDVAIINHNHVGFTNNIQRINLASEATTL 269 DT+ ++N HV N++Q + SEA TL Sbjct: 230 DTVKQFEGMMNQTHVKAINHLQEVVRVSEAQTL 262 >SPAC637.05c |vma2||V-type ATPase V1 subunit B |Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 213 VGFTNNIQRINLASEATTLLVLGPGLPASEGPPMLLRE 326 + FT + RI ++ + + G GLP +GP +L + Sbjct: 89 IDFTGHSMRIPVSEDMLGRVFNGSGLPIDKGPNLLAED 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,211,850 Number of Sequences: 5004 Number of extensions: 36663 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -