BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0046 (817 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83307-7|CAM13057.1| 531|Homo sapiens elongation protein 4 homo... 31 6.6 Z83307-6|CAM13056.1| 424|Homo sapiens elongation protein 4 homo... 31 6.6 Z83001-1|CAM28371.1| 531|Homo sapiens elongation protein 4 homo... 31 6.6 BC012514-1|AAH12514.1| 535|Homo sapiens ELP4 protein protein. 31 6.6 AK000505-1|BAA91212.1| 424|Homo sapiens protein ( Homo sapiens ... 31 6.6 >Z83307-7|CAM13057.1| 531|Homo sapiens elongation protein 4 homolog (S. cerevisiae) protein. Length = 531 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 380 NILRKCSAPLTADKYKRHFNSTALSHSRPMA*ASLENIW 264 NIL++ APL DK K+ F+ +H P + ++ W Sbjct: 124 NILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAW 162 >Z83307-6|CAM13056.1| 424|Homo sapiens elongation protein 4 homolog (S. cerevisiae) protein. Length = 424 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 380 NILRKCSAPLTADKYKRHFNSTALSHSRPMA*ASLENIW 264 NIL++ APL DK K+ F+ +H P + ++ W Sbjct: 124 NILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAW 162 >Z83001-1|CAM28371.1| 531|Homo sapiens elongation protein 4 homolog (S. cerevisiae) protein. Length = 531 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 380 NILRKCSAPLTADKYKRHFNSTALSHSRPMA*ASLENIW 264 NIL++ APL DK K+ F+ +H P + ++ W Sbjct: 124 NILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAW 162 >BC012514-1|AAH12514.1| 535|Homo sapiens ELP4 protein protein. Length = 535 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 380 NILRKCSAPLTADKYKRHFNSTALSHSRPMA*ASLENIW 264 NIL++ APL DK K+ F+ +H P + ++ W Sbjct: 124 NILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAW 162 >AK000505-1|BAA91212.1| 424|Homo sapiens protein ( Homo sapiens cDNA FLJ20498 fis, clone KAT08960. ). Length = 424 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 380 NILRKCSAPLTADKYKRHFNSTALSHSRPMA*ASLENIW 264 NIL++ APL DK K+ F+ +H P + ++ W Sbjct: 124 NILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAW 162 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,002,351 Number of Sequences: 237096 Number of extensions: 2620642 Number of successful extensions: 8009 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8007 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10147868276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -