BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0044 (495 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 4.6 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 6.1 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 8.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 391 EIGTNCNKILPADGAIPSHCTLAPILLSPK 302 EI N I+ G + LAPI SP+ Sbjct: 91 EINPNLKTIISIGGWNAGNAILAPIAASPE 120 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 156 RRRVSIWCKGYTRTLQKRTKKIRYL 230 R+R ++ K T L++R ++ RYL Sbjct: 41 RKRRVLFSKAQTYELERRFRQQRYL 65 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.6 bits (41), Expect = 8.1 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -3 Query: 40 VYLRCWNA 17 VY+ CWNA Sbjct: 381 VYIPCWNA 388 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +2 Query: 14 NSIPTAQIHHNGENLKGKRDRNRSPLRQKLVFYHQRLLNTKTENT 148 +SIP + NG K + N R L + + K+ N+ Sbjct: 1512 SSIPAKDVFENGHVNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNS 1556 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +2 Query: 14 NSIPTAQIHHNGENLKGKRDRNRSPLRQKLVFYHQRLLNTKTENT 148 +SIP + NG K + N R L + + K+ N+ Sbjct: 1512 SSIPAKDVFENGHVNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNS 1556 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +2 Query: 14 NSIPTAQIHHNGENLKGKRDRNRSPLRQKLVFYHQRLLNTKTENT 148 +SIP + NG K + N R L + + K+ N+ Sbjct: 1512 SSIPAKDVFENGHVNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNS 1556 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +2 Query: 14 NSIPTAQIHHNGENLKGKRDRNRSPLRQKLVFYHQRLLNTKTENT 148 +SIP + NG K + N R L + + K+ N+ Sbjct: 1512 SSIPAKDVFENGHVNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNS 1556 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,070 Number of Sequences: 336 Number of extensions: 2692 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11630247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -