BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0044 (495 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 7.6 AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 23 7.6 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 10.0 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 22.6 bits (46), Expect = 7.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 88 AQAKTCILPSETTKYQN*KHSTEEDAYRF 174 A+ +TC+LP E K Q E D Y F Sbjct: 457 AEKETCLLPLEDDKEQR----LEADRYNF 481 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 22.6 bits (46), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 184 PLHQIDTRLLQYCVFSFGI**SLMVEYKFLPER 86 P H + TRLL+Y +F GI ++ E + +P R Sbjct: 46 PNHHLATRLLRYFIFG-GIIQAISAETR-IPRR 76 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.2 bits (45), Expect = 10.0 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +2 Query: 74 RNRSPLRQKLVF----YHQRLLNTKTENTVLKKTRIDLVQRLHAYIAK 205 R+ S RQ +F H+ +L T + K ++ LVQ+ +YI + Sbjct: 41 RDESAGRQDKLFDTIRLHKEVLQTVKLQPISMKRKLRLVQQAKSYITR 88 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,719 Number of Sequences: 2352 Number of extensions: 10916 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -