BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0044 (495 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075460-1|AAL68273.1| 480|Drosophila melanogaster RE16208p pro... 30 1.5 AE013599-3922|AAF47246.2| 478|Drosophila melanogaster CG13594-P... 30 1.5 AF427496-1|AAL25120.1| 734|Drosophila melanogaster occludin-lik... 28 6.0 >AY075460-1|AAL68273.1| 480|Drosophila melanogaster RE16208p protein. Length = 480 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 198 LQKRTKKIRYLQ--KWRKK*RGPRSSASVLGECVK*CLGDNNIGANVQWDGMAPSAGS 365 + K+TK ++YL+ KWR P + ++ E NN G N++ + AGS Sbjct: 231 IAKKTKFLKYLEEEKWRSNAAVPEDAGAISNEAEPSTPSGNNNGGNLKNQSNSREAGS 288 >AE013599-3922|AAF47246.2| 478|Drosophila melanogaster CG13594-PA protein. Length = 478 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 198 LQKRTKKIRYLQ--KWRKK*RGPRSSASVLGECVK*CLGDNNIGANVQWDGMAPSAGS 365 + K+TK ++YL+ KWR P + ++ E NN G N++ + AGS Sbjct: 229 IAKKTKFLKYLEEEKWRSNAAVPEDAGAISNEAEPSTPSGNNNGGNLKNQSNSREAGS 286 >AF427496-1|AAL25120.1| 734|Drosophila melanogaster occludin-like protein protein. Length = 734 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 56 LKGKRDRNRSPLRQKLVFYHQRLLNTKTENTVLKKTRIDLVQRLH 190 LK K ++ R + Q++ H+R+ N + + ++ DL ++LH Sbjct: 278 LKSKAEKERDEMAQEMETLHERIENYQDQISLKTSQVNDLTEKLH 322 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,876,024 Number of Sequences: 53049 Number of extensions: 480321 Number of successful extensions: 1265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1742533632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -