BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0040 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.46 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 27 0.80 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.3 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 5.7 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 0.46 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 12 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 140 + G Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 26.6 bits (56), Expect = 0.80 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 6/36 (16%) Frame = +1 Query: 634 GSWKTPSKQKKNFNLPQP------KMANTDLTRLLK 723 G K P K+KK +LP+P K N DL ++LK Sbjct: 153 GQSKQPKKKKKKRSLPKPEAVVIEKCENIDLAKVLK 188 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 635 PNKGSSLPNAD*VQMTKRPR*PPGA 561 P G P V M RP+ PPGA Sbjct: 212 PRPGGMYPQPPGVPMPMRPQMPPGA 236 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 142 RPPRHMLPKAP*PDLWVPPPRTRGIRATARP 50 RPP H P W+ PP R +TA P Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRPTTSTAAP 123 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,725 Number of Sequences: 2352 Number of extensions: 15442 Number of successful extensions: 62 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -