BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0038 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) 68 5e-12 SB_34916| Best HMM Match : adh_short (HMM E-Value=4.8e-06) 31 0.55 SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 29 2.9 SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_44212| Best HMM Match : DUF1071 (HMM E-Value=5.9) 28 5.1 SB_50399| Best HMM Match : EPTP (HMM E-Value=0.041) 28 5.1 SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) Length = 92 Score = 67.7 bits (158), Expect = 5e-12 Identities = 33/67 (49%), Positives = 42/67 (62%) Frame = +3 Query: 216 LTCWSQDCHQDLRGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQG 395 L + D + GRK G PSHF S S+AR L+ LE +KLVEK GGR +T+QG Sbjct: 22 LAPYDPDWYYIRAGRKNRGSAPSHFEVGSASVARSVLKGLEQIKLVEKASTGGRNITSQG 81 Query: 396 RRDLDRI 416 +RD+DRI Sbjct: 82 QRDMDRI 88 Score = 58.8 bits (136), Expect = 2e-09 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +1 Query: 88 TGKVKVPEHMDLVKTARFKELAPYDPDWFYVR 183 +G +K+P+ +DLVKT +FKELAPYDPDW+Y+R Sbjct: 2 SGNLKIPDWVDLVKTGKFKELAPYDPDWYYIR 33 >SB_34916| Best HMM Match : adh_short (HMM E-Value=4.8e-06) Length = 251 Score = 31.1 bits (67), Expect = 0.55 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 4 HEGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTAR-FKELAPYDPD 168 H G M + + + K+++ LKK G + V + VKT + FK+ AP P+ Sbjct: 165 HSGGMYASRASKCALNMVTKSLSVDLKKDGILAVAVNPGFVKTRKEFKDAAPLTPE 220 >SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.9 bits (64), Expect = 1.3 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +1 Query: 28 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMD-LVKTARFKELAPYDPDWFYVRCAAILRH 204 TV V K KT ++VP ++ L T R E+ + W V+C Sbjct: 221 TVNKVTGRKYTKTFVIMSGSNRPMRVPHSLEPLTLTNRVAEVT-FCRSWNAVKCTKYCAL 279 Query: 205 IYIRSPVGVKTVTKIFG 255 IY+ S + + V K+ G Sbjct: 280 IYLHSRLDTQPVNKVIG 296 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 284 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 376 TF ++ C +GF ++G +S+G+WS Sbjct: 21 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 51 >SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 284 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 376 TF ++ C +GF ++G +S+G+WS Sbjct: 286 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 316 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 284 TFLQVIRQYCTQGFAIVGG-IEAC*ESSGRWS 376 TF + C +GF ++G + +C +SSG+WS Sbjct: 112 TFPNKVTFSCDEGFILIGSPLRSC-QSSGKWS 142 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 39 C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDSSLQRAGSV 158 C QDC + RC +KNG + T A G CK S + ++ Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGSDCTNSPAI 339 >SB_44212| Best HMM Match : DUF1071 (HMM E-Value=5.9) Length = 274 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 205 IYIRSPVGVKTVTKIFGGANVMELHLHISAGHQAVLHARLCNRW 336 +Y+ + +G + K+FGG V L+ H + +A++H LC +W Sbjct: 170 LYV-ADLGEISYGKLFGGV-VSRLYFHYAG--EALIHDTLCTKW 209 >SB_50399| Best HMM Match : EPTP (HMM E-Value=0.041) Length = 204 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 448 RLSNKSLYFNFMLIKI*NLK 507 R+ NKS++FNF ++KI N + Sbjct: 48 RVENKSIFFNFQVLKIANAR 67 >SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 284 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWSHSHHT 391 T+ I C +G+A++G +++G WS S+ T Sbjct: 913 TYSSTINITCDEGYALIGPESRVCQANGTWSGSNVT 948 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,261,961 Number of Sequences: 59808 Number of extensions: 307182 Number of successful extensions: 740 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -