BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0038 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 1.1 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 1.5 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 1.5 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 1.5 CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 23 4.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 4.5 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 5.9 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 7.9 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.4 bits (53), Expect = 1.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 204 YLHSLTCWSQDCHQ 245 YLH L W CHQ Sbjct: 549 YLHGLVSWGYGCHQ 562 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 25.0 bits (52), Expect = 1.5 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Frame = +2 Query: 158 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSGAQT*W----SYTFTFLQVIRQYCTQ 319 +T+IG +C L +F L+E S + W TF+Q++ Q C + Sbjct: 384 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQK 443 Query: 320 GFAIVG 337 I G Sbjct: 444 AMTISG 449 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 25.0 bits (52), Expect = 1.5 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Frame = +2 Query: 158 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSGAQT*W----SYTFTFLQVIRQYCTQ 319 +T+IG +C L +F L+E S + W TF+Q++ Q C + Sbjct: 237 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMKAAYSCHWYDGSEEAKTFVQIVCQQCQK 296 Query: 320 GFAIVG 337 I G Sbjct: 297 AMTISG 302 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 25.0 bits (52), Expect = 1.5 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Frame = +2 Query: 158 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSGAQT*W----SYTFTFLQVIRQYCTQ 319 +T+IG +C L +F L+E S + W TF+Q++ Q C + Sbjct: 384 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQK 443 Query: 320 GFAIVG 337 I G Sbjct: 444 AMTISG 449 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 121 LVKTARFKELAPYDPDWFYV 180 +V RF+++A PDW +V Sbjct: 161 VVSNDRFRDVASEHPDWAFV 180 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 256 GANVMELHLHISAGHQAVLHARL 324 G M LH H GH A LHA L Sbjct: 342 GMGSMGLHHH-HPGHHAALHAHL 363 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 330 IAKPCVQYCLMTCRNVKV*LHYVCAPEDLGDSL 232 + KPC+ + + RN+ V C DLG +L Sbjct: 364 LVKPCICHRDLNSRNILVKSDLSCCIGDLGFAL 396 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.6 bits (46), Expect = 7.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -3 Query: 134 AVFTRSMCSGTLTLPVFFK*AATVLTILSCSTSFTVTERILPSC 3 AV ++ +G LP AT+L ILS ++ ++ C Sbjct: 2 AVRNSTLTAGRHRLPALVLVTATILPILSLMVPIGHSQSVITDC 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,136 Number of Sequences: 2352 Number of extensions: 9684 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -