BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0028 (400 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 33 0.086 SB_28806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_29258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_43858| Best HMM Match : TPR_2 (HMM E-Value=0.0013) 27 7.4 SB_35100| Best HMM Match : TPR_2 (HMM E-Value=0.0013) 27 7.4 SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 26 9.8 SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 33.1 bits (72), Expect = 0.086 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +3 Query: 21 PLAID--LLHPSPA-SERRKHKL-KRLVPHPNSYFMDVKCPGCYKITTVFSHAQRV 176 PL D L H P S R K + KR P P ++K P Y++TT+ +H+ RV Sbjct: 404 PLTRDPTLTHSVPIISGRLKTSMNKRTKPKPGERATEIKSPSTYQVTTMVTHSPRV 459 >SB_28806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 27.5 bits (58), Expect = 4.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 123 KCPGCYKITTVFSHAQRVVVCAGC 194 +CP CY ++ V + Q V C+ C Sbjct: 208 RCPRCYPMSKVLPNVQGVTQCSRC 231 Score = 26.6 bits (56), Expect = 7.4 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +3 Query: 66 RKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGC 194 R + + +++P+ + +CP CY ++ V Q V C C Sbjct: 306 RCYPVSKVLPNVRGF---TQCPRCYPVSKVLPSVQGVTRCPRC 345 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 123 KCPGCYKITTVFSHAQRVVVCAGC 194 +CP CY ++ V Q V C C Sbjct: 341 RCPRCYPVSKVLPGVQGVTQCPRC 364 >SB_29258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 78 LKRLVPHPNSYFMDVKCPGCYKI 146 ++RLVP NSY + + GC I Sbjct: 95 VRRLVPRTNSYILSIDLEGCTSI 117 >SB_43858| Best HMM Match : TPR_2 (HMM E-Value=0.0013) Length = 517 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 94 HILTLISWMLSALAVTRLQQFLVTHREWWSALD 192 H T + W+L ++ + Q + +R+W SA D Sbjct: 473 HQATAVWWVLPSVLYSNRAQCYINNRDWQSAAD 505 >SB_35100| Best HMM Match : TPR_2 (HMM E-Value=0.0013) Length = 158 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 94 HILTLISWMLSALAVTRLQQFLVTHREWWSALD 192 H T + W+L ++ + Q + +R+W SA D Sbjct: 114 HQATAVWWVLPSVLYSNRAQCYINNRDWQSAAD 146 >SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 412 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 97 ILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRS 204 + L+S+ L LAV + L+ HR W+S + + + Sbjct: 207 LCVLVSFYLIPLAVMAVLYALIAHRLWFSRIPVENA 242 >SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 26.2 bits (55), Expect = 9.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 179 HHSLCVTKNCCNLVTARALNIHEIRVR 99 HHS+ + K C VT+ +L+ H + R Sbjct: 201 HHSMNLEKKCATRVTSESLDSHSSKDR 227 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 26.2 bits (55), Expect = 9.8 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 87 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 209 L H N+ D+KC C + Q + CA CS LC Sbjct: 472 LAIHSNASRKDLKCENCN------NKKQAIARCAHCSVFLC 506 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 26.2 bits (55), Expect = 9.8 Identities = 16/70 (22%), Positives = 26/70 (37%) Frame = +3 Query: 57 SERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARL 236 S R KH + + SY++ V+ CY + F H + + C P+ Sbjct: 458 SSRHKHPGELITTMTGSYYIPVEKHICYGLQASFIHPNLTLYKKHDFAVTCSPSTSSIGP 517 Query: 237 TEGCSFEENN 266 + F E N Sbjct: 518 SSLYKFVEGN 527 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,428,129 Number of Sequences: 59808 Number of extensions: 226674 Number of successful extensions: 565 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -