BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0027 (787 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 66 4e-11 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 64 1e-10 05_07_0258 - 28729620-28729782,28730193-28730339,28730808-287310... 30 2.4 02_02_0470 - 10700092-10700505 30 2.4 01_06_1446 - 37409074-37409783,37409896-37409986,37410645-374119... 29 3.2 10_08_0951 - 21769342-21769752 29 5.5 11_06_0284 + 21909758-21913645 28 7.3 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 65.7 bits (153), Expect = 4e-11 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Frame = +2 Query: 287 FYPTQE-KIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLV 463 FYP + K RA S + + ++R + GTV ILLAGR+ GKRVV + L SGLLL+ Sbjct: 50 FYPADDVKPRAPSTRKA---NPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLI 106 Query: 464 TGPFAFNSCPLRRIPSA 514 TGPF N P+RR+ A Sbjct: 107 TGPFKINGVPIRRVNQA 123 Score = 48.0 bits (109), Expect = 8e-06 Identities = 37/96 (38%), Positives = 50/96 (52%), Gaps = 2/96 (2%) Frame = +1 Query: 472 FCIQFVPATPYS*RYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFA 651 F I VP + YVI TST++ + K+ K F+D YF EG+ +F Sbjct: 110 FKINGVPIRRVNQAYVIATSTKVDISGVKVDK-FDDKYFARDKKAKAKKT---EGE-LFE 164 Query: 652 TKKE--KYVPSEQRKTDQKTVDEAVIKAIGARPDKK 753 T+KE K +P + +K DQK VD +IKAI PD K Sbjct: 165 TEKEATKNLP-DFKKDDQKAVDAELIKAIEVVPDLK 199 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 64.1 bits (149), Expect = 1e-10 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +2 Query: 293 PTQEKIRASSGGRPFS--KHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVT 466 PT+ + +SS FS + + +R ++ GTV ILLAGR GKRVV + L SGLLLVT Sbjct: 71 PTKLRSPSSSNLPEFSLFRFILLMRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVT 130 Query: 467 GPFAFNSCPLRRI 505 GPF N P+RR+ Sbjct: 131 GPFKINGVPIRRV 143 Score = 48.4 bits (110), Expect = 6e-06 Identities = 38/96 (39%), Positives = 50/96 (52%), Gaps = 2/96 (2%) Frame = +1 Query: 472 FCIQFVPATPYS*RYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFA 651 F I VP + YVI TST++ + + K F+D YF EG+ +F Sbjct: 133 FKINGVPIRRVNQPYVIATSTKVDISGVNVEK-FDDKYFSRDKKQKAKKT---EGE-LFE 187 Query: 652 TKKE--KYVPSEQRKTDQKTVDEAVIKAIGARPDKK 753 T+KE K +P E +K DQK VD +IKAI A PD K Sbjct: 188 TEKEATKNLP-EFKKEDQKVVDAELIKAIEAVPDLK 222 >05_07_0258 - 28729620-28729782,28730193-28730339,28730808-28731032, 28731148-28731178,28731424-28731940 Length = 360 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 3/71 (4%) Frame = -1 Query: 433 NKYNPLACMSTSEENANSSYLQVGSDPAYMLAEWTATR*GTDFLLSGVEGLPTFEGYCSG 254 N Y + TS + A ++ L +DP+ ++ +T G L + P F GY + Sbjct: 147 NSYYQKNPVQTSCDFAGTAIL-TSTDPSSSSCKYPSTSTGASVLNTSTPTNPAFGGYDNS 205 Query: 253 PPFF---SPPI 230 PP F SPP+ Sbjct: 206 PPGFGNNSPPL 216 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 368 LKIGTVCILLAGRHAGKRVVLVGILPSG 451 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >01_06_1446 - 37409074-37409783,37409896-37409986,37410645-37411988, 37412062-37412709,37412801-37412852,37413141-37413214, 37414370-37414419,37414488-37414569,37414779-37414828, 37414907-37414949,37415030-37415110,37415198-37415243, 37415336-37415382,37415467-37415532,37415612-37415678, 37415761-37415858 Length = 1182 Score = 29.5 bits (63), Expect = 3.2 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +2 Query: 542 HSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSMRL* 721 HS+ + + S +TSR SA + KR S P K + S K +Q Sbjct: 430 HSSDISSSSKSSEVTSRE--SAKVICEPVKRAQASPPLKHLSPIVEHSPKAKIKQD---- 483 Query: 722 SKPLEPDPTRRCSAILKAAFG 784 +PL+PDP ++ + AA G Sbjct: 484 -EPLQPDPAKQAMEDVDAAVG 503 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 368 LKIGTVCILLAGRHAGKRVVLVGILPSG 451 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 >11_06_0284 + 21909758-21913645 Length = 1295 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 649 ATKKEKYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRDTQGG 777 A ++E+ + KT T+DE IK + + +LR+ QGG Sbjct: 574 AQQQERLAAKQATKTATTTLDEERIKQMINEAKQDILRELQGG 616 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,603,765 Number of Sequences: 37544 Number of extensions: 494463 Number of successful extensions: 1251 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -