BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0026 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 26 4.1 SPAC23H4.04 |||tRNA|Schizosaccharomyces pombe|chr 1|||Manual 26 5.5 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 112 RNITSCNKNQTRKVIVCIITGGRT 183 +N K+ +KV+VCII+ GRT Sbjct: 222 KNSQVWGKDAWKKVVVCIISDGRT 245 >SPAC23H4.04 |||tRNA|Schizosaccharomyces pombe|chr 1|||Manual Length = 415 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 135 FITRCYIPSPCFKNTILSLLK-TKNDLLSLDCVYGMFWK 22 + R Y+ KN L + + T N+LL C+Y WK Sbjct: 297 YFGRWYVWKKDIKNNALYICRGTNNELLMSKCIYLKDWK 335 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,597,616 Number of Sequences: 5004 Number of extensions: 50774 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -