BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0025 (832 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0148 - 5928703-5928931,5929099-5929171,5929288-5929408,592... 30 2.6 07_03_0464 + 18456502-18456697,18457281-18457368,18457448-184575... 29 3.4 06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627 29 3.4 01_07_0083 + 40970890-40971015,40971886-40971994,40972679-409727... 29 3.4 08_02_0075 - 11953723-11956203,11958213-11958512 29 4.5 09_04_0551 - 18488584-18490017 29 6.0 >03_02_0148 - 5928703-5928931,5929099-5929171,5929288-5929408, 5929907-5929952,5930361-5930571,5930837-5930986, 5931122-5931179,5931285-5931400,5931986-5932091 Length = 369 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 187 NVFQYIKYIKASDGFFGCYRGLS 255 N+FQ I+ + SDG G YRG+S Sbjct: 78 NIFQMIRTVWVSDGLKGFYRGIS 100 >07_03_0464 + 18456502-18456697,18457281-18457368,18457448-18457524, 18457844-18457883,18458109-18458175,18458908-18458993, 18459380-18459461,18459778-18459834,18460135-18460173, 18460402-18460472,18460912-18461047,18461048-18461092 Length = 327 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 694 YNKHNNIS-NGCGIYLYGSSWF*FKAGNPPAM-PNYPSWQV 810 YN+H + G GIY G SW+ ++G+ M P P W V Sbjct: 248 YNQHGLLLLEGQGIYRLGDSWYPVQSGDTIWMAPFVPQWLV 288 >06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627 Length = 419 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 178 ILPNVFQYIKYIKASDGFFGCYRGLSQECLVLSP 279 + NVF + I ++G G Y+GL C+ L P Sbjct: 362 VYKNVFHALYCIMENEGIGGLYKGLGPSCIKLMP 395 >01_07_0083 + 40970890-40971015,40971886-40971994,40972679-40972790, 40972944-40973100,40973609-40973761,40974143-40974292, 40974803-40974999,40975446-40975473 Length = 343 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +1 Query: 82 CHPMEYAKVLIQLGYEPLAPRRSTTLFGRPAMILPNVFQYIKYIKASDGFFGCYRGLSQE 261 CHP++ K Q+ PR + + ++ +K I A +GF G Y+GL Sbjct: 258 CHPLDVVKKRFQIEGLKRHPRYGARI---ESSTYKGMYHALKEIVAKEGFGGLYKGLFPS 314 Query: 262 CLVLSP 279 + +P Sbjct: 315 LVKSAP 320 >08_02_0075 - 11953723-11956203,11958213-11958512 Length = 926 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +2 Query: 527 SIYKDDGILGFLHGLIPKVLGDLTCLAVTGVLAYYVNKYFVKTKD-LRYYTIPLLT 691 SI ++D L + VLG L CL + GV + FVKT + +RY + LT Sbjct: 553 SIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLT 608 >09_04_0551 - 18488584-18490017 Length = 477 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 279 ASQLTSKVIVAVGID-LPEINDPPNIVTDDEPKVEDYIKLGRR 404 A ++SK V LP I DPP++ DD+ +Y L RR Sbjct: 54 ARAVSSKSSATVSFHMLPRIPDPPSLAFDDDKFFTNYFDLVRR 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,159,878 Number of Sequences: 37544 Number of extensions: 534077 Number of successful extensions: 1282 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1282 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -