BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0025 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 25 0.86 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 25 0.86 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 25 1.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.0 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 8.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 8.0 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 8.0 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 25.0 bits (52), Expect = 0.86 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +3 Query: 366 EPKVEDYIKLGRRDMIMQTVAVVIAHPFHVVSVR-MMASFIGKEE-HYSS---CWA 518 +PK ++ ++ TVA ++++PF V R MM S K E Y S CWA Sbjct: 206 DPKKTPFLISWGIAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWA 261 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 25.0 bits (52), Expect = 0.86 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +3 Query: 366 EPKVEDYIKLGRRDMIMQTVAVVIAHPFHVVSVR-MMASFIGKEE-HYSS---CWA 518 +PK ++ ++ TVA ++++PF V R MM S K E Y S CWA Sbjct: 206 DPKKTPFLISWGIAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWA 261 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 24.6 bits (51), Expect = 1.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 712 CYCACYKCK 686 CYC C KCK Sbjct: 2 CYCTCEKCK 10 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +2 Query: 482 YWERRTLQL 508 +WERRTLQ+ Sbjct: 187 FWERRTLQI 195 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +2 Query: 482 YWERRTLQL 508 +WERRTLQ+ Sbjct: 240 FWERRTLQI 248 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +2 Query: 623 AYYVNKYFVKTKDLRYYTIPLLTFITSTITY 715 AYY++++ + DL YY +L + + + + Sbjct: 181 AYYLHQFAPEQPDLNYYNPVVLDDMQNVLRF 211 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/11 (63%), Positives = 11/11 (100%) Frame = +1 Query: 100 AKVLIQLGYEP 132 AK+L+Q+G+EP Sbjct: 163 AKLLLQMGFEP 173 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +2 Query: 623 AYYVNKYFVKTKDLRYYTIPLLTFITSTITY 715 AYY++++ + DL YY +L + + + + Sbjct: 181 AYYLHQFAPEQPDLNYYNPVVLDDMQNVLRF 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 251,845 Number of Sequences: 438 Number of extensions: 6299 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -