BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0015 (461 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 0.56 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 0.98 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 25 1.7 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 24 3.0 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 24 3.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 5.2 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 22 9.1 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 22 9.1 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 22 9.1 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 0.56 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 138 GSERPQDAAENADFSFSGTD*C*NSGN 58 GSE+P++A E + + SGTD +SG+ Sbjct: 1348 GSEKPKNAIEPSQEAVSGTDNANDSGD 1374 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 0.98 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 335 LRSRGQPCSGVRRPTRHQQITVNYSNDTCESK 430 L + P G RRPT++QQI +++D E++ Sbjct: 16 LANEFNPNRGRRRPTKNQQIYGVWADDDSENE 47 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 24.6 bits (51), Expect = 1.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 380 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 +LGD +N D+G R DL+ E + +N + EEI E+D Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 24.6 bits (51), Expect = 1.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 380 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 +LGD +N D+G R DL+ E + +N + EEI E+D Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 294 VNNFLEKIPVYLTDYAAEVS 353 VN EK+P YL++ +A V+ Sbjct: 88 VNAIYEKLPAYLSEVSARVN 107 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.8 bits (49), Expect = 3.0 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 4/101 (3%) Frame = -1 Query: 380 ELGDVLQNTADLGCVVRQVDR-DLL*EVVDGWSNFASEEIDLELDLTSPIVIA---APMS 213 EL D N +V +LL + +G S +E+ + LD+ I P + Sbjct: 67 ELVDYNPNVTTTNIIVSPFSAWNLLTLITEGASGRTLDELLVALDVQQQEQIRNYYKPFA 126 Query: 212 LTMMLSARETEAVASATTFSRASPPEAKDLRTRLKMRISPS 90 + L R+ + A+ + + P +KD + L SPS Sbjct: 127 QSFSLLDRDVQLAAAQYVITDENRPVSKDFESALDNFYSPS 167 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 5.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 180 SGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD 79 S ++ ND +K +SGS + Q E F F D Sbjct: 1270 SVTIKNDPMK--TSGSTQQQQQMERQQFGFGNND 1301 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 22.2 bits (45), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 323 LPDGLRSRGQPCSGVRR 373 LP RSR +P GVRR Sbjct: 3 LPRSPRSRTRPARGVRR 19 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 9 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 9 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 9 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 9 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 42 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 7 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 40 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 8 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 41 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 8 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 41 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 350 DLGCVVRQVDRDLL*EVVDGWSNFASEEIDLELD 249 D+G R DL+ E + +N + EEI E+D Sbjct: 6 DIGEKRRLAFLDLMIETANNGANISDEEIKEEVD 39 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 22.2 bits (45), Expect = 9.1 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 378 VGRRTPEHG*PRLRSP--SGRQGS 313 VG++ P G P LR+P +G GS Sbjct: 20 VGKQLPASGIPTLRAPMAAGNAGS 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,250 Number of Sequences: 2352 Number of extensions: 7847 Number of successful extensions: 69 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -