BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0006 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 25 0.64 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 2.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.4 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.9 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 7.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 7.8 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 25.0 bits (52), Expect = 0.64 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 205 RDDLSRMPGRIEVVGVFRRFF--LGALLT 125 +D+L + P RI G+FRRF+ LG L T Sbjct: 538 KDELGK-PSRISKQGLFRRFYNLLGKLST 565 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 574 NYYMFNLSLRDTRWTVI 624 NYY+FNL++ D + ++ Sbjct: 69 NYYLFNLAVSDLLFLIL 85 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 246 PNTDGLLINRQLWLAEGLLSCQTKGGRYCG 335 P+ D I+ + +LAE S +YCG Sbjct: 59 PSIDRSSIHEESYLAESSRSIDPCASKYCG 88 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/18 (38%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -3 Query: 325 RPPF-VWQLNSPSASHSC 275 RP + W+LN+ ++ H+C Sbjct: 8 RPSYCTWELNATNSPHTC 25 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 5.9 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = -2 Query: 359 IHPNTPRVSAIASSFR 312 IHP PR+ ++ ++++ Sbjct: 160 IHPGDPRIKSVVTAYK 175 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 56 EAFFDEYDYYNFD 94 E + D+YDY N D Sbjct: 21 ELYSDKYDYVNID 33 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 56 EAFFDEYDYYNFD 94 E + D+YDY N D Sbjct: 21 ELYSDKYDYVNID 33 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,264 Number of Sequences: 438 Number of extensions: 4134 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -