BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0004 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3... 29 2.2 At2g42570.1 68415.m05268 expressed protein 28 6.6 >At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3) family protein contains Pfam profile: PF05879 root hair defective 3 GTP-binding protein (RHD3) family Length = 834 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 41 PTNADSLARLFQLLLDV*VSSRAS-NRS-GANTDPSKCSASQNLPPD 175 P N +S LF L+D VS+ +S NRS G +TDP S+ + +PP+ Sbjct: 598 PDNIEST--LFSSLMDGTVSAASSHNRSVGTSTDPLASSSWEEVPPN 642 >At2g42570.1 68415.m05268 expressed protein Length = 367 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 546 TKHTQVWSYLE*TSELYKEM 487 T+H Q W Y+E + LYK+M Sbjct: 212 TEHIQPWDYMEDGNRLYKDM 231 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,540,272 Number of Sequences: 28952 Number of extensions: 235582 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -