BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0002 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 72 7e-14 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 72.1 bits (169), Expect = 7e-14 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = +1 Query: 496 IRILFTILQAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFS 675 + LF QAYEY A FTI+D +YG++F+ ATG HGIH+I+GT+ LL+ H + Sbjct: 181 LSFLFLGGQAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTILLLVATYNIYTYHLT 240 Query: 676 KNHH 687 HH Sbjct: 241 NTHH 244 Score = 69.7 bits (163), Expect = 4e-13 Identities = 38/99 (38%), Positives = 50/99 (50%), Gaps = 2/99 (2%) Frame = +2 Query: 167 RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXXHRRLSPNIEIGRI*PP 346 RD+S E G HT V KGL+ G H LSP E+G + PP Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIGFMLFLISETFLFASIFWAFFHSSLSPTFELGAVWPP 128 Query: 347 SRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENN 457 I +P ++PLLNT+IL+ SG ++T AH+SLI N Sbjct: 129 VGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARN 167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,114,793 Number of Sequences: 5004 Number of extensions: 33699 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -