BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0001 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 3.8 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 3.8 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 3.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 3.8 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 5.0 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 6.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 6.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 119 TVILVWV*SAARKSPL 166 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 439 TLPLPRHMP 465 TLPLP+H+P Sbjct: 503 TLPLPQHLP 511 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 439 TLPLPRHMP 465 TLPLP+H+P Sbjct: 418 TLPLPQHLP 426 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 439 TLPLPRHMP 465 TLPLP+H+P Sbjct: 737 TLPLPQHLP 745 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +3 Query: 261 CKVTGKCGSVTVRLIPAPRGT 323 C + G CG + + P+GT Sbjct: 75 CPICGACGDIAHTVKYCPKGT 95 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 350 LRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDV 252 LRNW N + T YG ++ A+D+ Sbjct: 187 LRNWFSKNVNQTVAETVRIIYGGSVTAGNAKDL 219 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 448 LPRHMPTSL 474 LP+H+PTSL Sbjct: 379 LPKHLPTSL 387 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 8.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -1 Query: 314 RGRNQPDCYGTTLAGDLARDVCGFPILLP 228 RG QPD G DV G +LP Sbjct: 28 RGNPQPDIIWVRADGSAVGDVPGLRQVLP 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,603 Number of Sequences: 438 Number of extensions: 3871 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -